SKU: 13364544562

Mycobacterium tuberculosis fbpB/Ag85B Protein, His Tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 3 - Sep 8

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mycobacterium tuberculosis fbpB/Ag85B Protein, His TagProduct Specification Synonyms Diacylglycerol acyltransferase mycolyltransferase Ag85B, DGAT, 30 kDa extracellular protein, Acyl CoA: diacylglycerol acyltransferase, Antigen 85 complex B (85B; Ag85B), Extracellular alpha antigen, Fibronectin binding protein B (Fbps B), MT1934 Accession P9WQP0 Amino Acid Sequence Protein sequence (P9WQP0, Phe41 Gly325, with N His Tag)

Product Specification


Synonyms Diacylglycerol acyltransferase/mycolyltransferase Ag85B, DGAT, 30 kDa extracellular protein, Acyl-CoA:diacylglycerol acyltransferase, Antigen 85 complex B (85B; Ag85B), Extracellular alpha-antigen, Fibronectin-binding protein B (Fbps B), MT1934
Accession P9WQP0
Amino Acid Sequence

Protein sequence (P9WQP0, Phe41-Gly325, with N-His Tag) FSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG

Expression System HEK293
Molecular Weight Predicted MW: 32.3 kDa Observed MW: 35-43 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Ag85B is a major secreted antigen and mycolyltransferase of the Mycobacterium tuberculosis complex. This multifunctional enzyme plays a central role in constructing the unique mycobacterial cell wall. As part of the Ag85 complex, it catalyzes the transfer of mycolic acids—long-chain fatty acids—onto the arabinogalactan-peptidoglycan matrix, forming the essential mycolyl-arabinogalactan-peptidoglycan complex (mAGP). This creates the robust, hydrophobic outer membrane critical for pathogenicity and antibiotic resistance. Due to its high immunogenicity, Ag85B is also a leading candidate antigen in several tuberculosis vaccine strategies.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 13364544562

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
robert ferrell
Belleville, US
★★★★★ 5
Good
Color: Black, Size: 6 Panel
Love it , just what so needed , easy to put together (some what ) …
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
C
Verified Purchase
Crimm
Natrona Heights, US
★★★★★ 3
Decent for the price. Instructions suck but most people should be able to figure it out. More below.
Color: Black, Size: 6 Panel, Color: Black, Size: 6 Panel
SUMMARY: 3 stars from me because it's firmly average. It's fine for the price. Assembly and materials are alright but I can see some caveats depending on your circumstances. Assembly instructions do a subpar job of pointing out some details. ASSEMBLY INSTRUCTIONS: Maybe it's because I'm autistic and/or building model kits and assembling stuff is my jam, but I honestly thought people were exaggerating when they were complaining about the instructions and I'd be able to flex my ~superior assembly skills.~ I was wrong! These instructions genuinely suck, and whoever is responsible for making them should be ashamed. The instructions do a poor job of calling out some details regarding orientation of parts, and some of the images do not actually match the physical parts. For example, it does not really outline the assembly of the end panels clearly, and I can see someone accidentally using the wrong poles. I've drawn over a photo to show what you should do to try and make it clearer. Additionally, the manual shows a flathead screw for bolting the feet into position, but the actual screw is not a flathead. It also does not point out the counterbore, so if you aren't paying attention you may put the foot pads onto the wrong side of the foot. It's also missing the fact that you need to use another one of the plastic pieces when you finish assembling a panel. ACTUAL ASSEMBLY & MATERIALS: To their credit, all of my bags were clearly labeled. The assembly process wasn't difficult. It's mostly just tedious and requires a fair amount of space. I was able to assemble it by myself without any real difficulty. However, the way it's assembled means two things. One, the fabric parts aren't removable without disassembly. So if you want to use this in an environment where they would require cleaning, I would seriously recommend looking for another option. Or, you could buy this just to use the frame pieces and then somehow buy or make your own fabric pieces designed to be removable with velcro or something. Two, because of the materials I really don't have a lot of faith in this thing surviving disassembly and reassembly. Like a lot of sorta-cheap-but-convenient furniture, it uses those spring-button connections and plastic inserts with self-tapping screws. Those things are not really meant to be disassembled and rethreaded. It also relies a lot on the tension of the poles and the fabric to keep everything rigid and squared, which I think puts a lot of pressure on the aforementioned buttons, plastic inserts, and the hollow metal rods. So I feel like that will also cause issues with disassembly and reassembly. Basically once this thing is assembled, it's not really meant to be disassembled. The best you can do is spot-clean the fabric if you need to. Speaking of the fabric, I didn't see any labels on them or anything in the manual that says what they are, but they feel like some kind of polyester. They generate static electricity pretty easily, and pet hair and debris sticks easily. So that's another downside of them not being easily removable. For the most part it does seem pretty stable. The poles seem to be pretty uniform in length so they're all making contact with my floor. Obviously this isn't structural so it shouldn't be supporting anything, but the two main feet seem to be doing fine with keeping this thing upright. CLOSING THOUGHTS: Really, it's fine for what it is, but it could be better in a lot of little ways and the substandard quality of the instructions just seems unprofessional to me, which is why I'm being so harsh with my rating. Depending on your needs and environment you may want to consider a different option. Preferably one that is made to be disassembled with better materials, and/or one with fabric pieces made to be removed easily.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2023
B
Verified Purchase
Barb
Louisville, US
★★★★★ 1
Not as it seems
Color: Black, Size: 6 Panel
these are awful... Each individual panel is fine, but when you put it together it can barely stand up, and the clips that hold it together keep popping off. Steer clear of this item.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 7, 2026
T
Verified Purchase
Timothy Beckner
Dallas, US
★★★★★ 5
As described
Color: White, Size: 6 Panel
Works great in my clinic
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2026
O
Verified Purchase
OkieDokie
Whiting, US
★★★★★ 5
Stable, solid, and versatile!
Color: Black, Size: 8 Panel-176'' Wide, Color: Black, Size: 8 Panel-176'' Wide
Exceeded my expectations. Easy, but tedious to assemble. That said, it’s solid, well made, and will last. You can stand it up in a straight line without concern it will fall over. No need to fold it like an accordion for stability. Helped me separate my garage gym from the kids bikes, shelving, paint, tools, and typical garage stuff.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 13, 2025

recommand products