SKU: 10846696958

Human PRDM1/Blimp1 Protein, His tag

Sale price$195.75 Regular price$217.50
Save 10%

Pay in installments of $54.38 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human PRDM1/Blimp1 Protein, His tagProduct Specification Species Human Synonyms PR domain zinc finger protein 1, BLIMP 1, Beta interferon gene positive regulatory domain I binding factor, PR domain containing protein 1, Positive regulatory domain I binding factor 1 (PRDI BF1; PRDI binding factor 1), BLIMP1 Accession O75626 Amino Acid Sequence Protein sequence (O75626, Lys38 Gln223, with C His tag)

Product Specification


Species Human
Synonyms PR domain zinc finger protein 1, BLIMP-1, Beta-interferon gene positive regulatory domain I-binding factor, PR domain-containing protein 1, Positive regulatory domain I-binding factor 1 (PRDI-BF1; PRDI-binding factor 1), BLIMP1
Accession O75626
Amino Acid Sequence

Protein sequence (O75626, Lys38-Gln223, with C-His tag) KMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSRGELHHFIDGFNEEKSNWMRYVNPAHSPREQNLAACQNGMNIYFYTIKPIPANQELLVWYCRDFAERLHYPYPGELTMMNLTQ

Expression System E.coli
Molecular Weight Predicted MW: 23.5 kDa Observed MW: 25 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Liquid
Storage Buffer

Supplied as a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 5% glycerol.

Stability & Storage

12 months from date of receipt, -20℃ as supplied.

Background

PRDM1 (PR domain zinc finger protein 1) is a transcription factor critical for cell fate determination and terminal differentiation. It plays a pivotal role in B cell development, driving mature B cells into antibody-secreting plasma cells while repressing B cell identity genes. Beyond immunity, PRDM1 regulates differentiation in other lineages, such as T cells and epithelial cells, and acts as a tumor suppressor in multiple cancers by inhibiting cell proliferation and inducing apoptosis. Dysregulation of PRDM1 is linked to lymphoid malignancies (e.g., multiple myeloma, diffuse large B-cell lymphoma) and solid tumors.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 10846696958

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 18 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Christy D.
Charlottesville, US
★★★★★ 5
Aggressive chewer who loves fetch approved!!
Size: Medium, Size: Medium
I highly recommend the Chuck-It brand in general, especially for dogs with an aggressive bite. These balls are awesome and are the most durable balls I’ve bought for my 50 lbs lab mix. He has not been able to break one of them yet and we’ve had a few of the squeaky balls for months. They are a bit pricey but worth it. The one in the pic has been used for months, lives outside and you can see it’s still in great shape.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 22, 2025
T
Verified Purchase
Tasha U
Omaha, US
★★★★★ 5
Good quality dog ball for playing fetch
Size: Medium
My dog and family love these chuck it balls to play fetch with our dog. They are durable and fun. They squeak which is added fun for any dog! Regular tennis balls my dog chews apart and they get pretty gross after playing and being left outside. These can be easily washed off and cleaned. These balls last! Would recommend to anyone with a dog and would purchase again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 17, 2025
R
Verified Purchase
ryan johnson
Cuba, US
★★★★★ 5
Tough and sturdy
Size: Medium
Have lasted my dog for years now and she is a tough chewer. Worth the money
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 12, 2025
V
Verified Purchase
VegasHawkeye
Lake Worth, US
★★★★★ 5
Picky dog approved!
Color: S6-muti-color, Color: S6-muti-color
I have wasted so much money on dog balls that they won't even pick up! They finally were obsessed with the Kong rubber green/blue or red/blue ones, but they're $3+. each, and they break from the dogs squishing it. I honestly had zero expectations on these, and they BOTH picked them up on the first throw! That's huge!! Seem to work fine in the ChuckIt. As for the squeaker, at first I was like "Oh nooooo." when they both loudly started! Much to my (and my neighbors') happiness, the squeakers stopped working after a couple minutes. 🤣
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 2, 2025
W
Verified Purchase
William Lovelace
Houston, US
★★★★★ 5
Great dog toys
Color: S6-muti-color
These are long lasting, durable dog toys. My dogs love the squeak sound.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026

recommand products