SKU: 9596224119

Her3 His Tag Protein, Human

Sale price$243.00 Regular price$270.00
Save 10%

Pay in installments of $67.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 11 - Sep 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Her3 His Tag Protein, HumanProduct Specification Species Human Synonyms Her3, FERLK, LCCS2, VSCN1 Accession P21860 Amino Acid Sequence Ser20 Thr643, with C terminal 10*His

Product Specification


Species Human
Synonyms Her3, FERLK, LCCS2, VSCN1
Accession P21860
Amino Acid Sequence

Ser20-Thr643, with C-terminal 10*His SEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEPREFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPIYKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLTGGGSGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

80-95kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Zhang N. et al. (2016) HER3/ErbB3, an emerging cancer therapeutic target. Acta Biochim Biophys Sin. 48(1): 39-48.

Background

HER3 is a member of the HER (EGFR/ErbB) receptor family consisting of four closely related type 1 transmembrane receptors (EGFR, HER2, HER3, and HER4). HER receptors are part of a complex signaling network intertwined with the Ras/Raf/MAPK, PI3K/AKT, JAK/STAT, and PKC signaling pathways. Aberrant activation of the HER receptors and downstream signaling molecules tips the balance on cellular events, leading to various types of cancers. The HER3 protein is expressed in several types of tumors. That fact, together with the role of HER3 in promoting cell proliferation, implicate that targeting HER3 may have therapeutic relevance. Furthermore, expression and activation of HER3 has been linked to resistance to drugs that target other HER receptors such as agents that act on EGFR or HER2.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 9596224119

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
Bossman
Lowell, US
★★★★★ 5
Absolutely Love This Receiver
The Onkyo TX‑NR7100 has completely transformed my home theater. The sound quality is rich, detailed, and powerful, and the 9.2‑channel setup gives movies and music a level of immersion I didn’t realize I was missing. Dirac Live right out of the box is a huge win — the room correction made an immediate, noticeable improvement. Setup was smooth, the interface is clean, and everything from streaming to switching inputs feels fast and reliable. It also plays perfectly with the rest of my system, and the THX certification really shows in how cinematic everything sounds. I absolutely love this receiver. It’s one of those upgrades that makes you wonder why you didn’t do it sooner.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 20, 2026
J
Verified Purchase
James Tepper
Houston, US
★★★★★ 5
Incredible 9.2 Surround receiver at an unbeatable price.
I may return at a future date to give a more complete review, but others that are much more knowledgeable about audio equipment than I have already done so. For me, the Onkyo (Onkyo TX-NR7100 9.2-Channel 8K/4K Network A/V Receiver) replaced a much older (2001) TX DS787 5.1 100 W Surround receiver that listed new for around $1050. I probably didn't pay quite that much but certainly something near $900. It was great for its time, perhaps even advanced with THX, Dolby, and other listening modes. But it didn't have: HDMI inputs or outputs, any BlueTooth capability, no hard wired or WiFi connectivity or basically any operating or connection modes that most all modern receivers have. This turned into a big problem with modern LED/LCD/OLED TVs, Alexa and other now common devices. I bought my new Onkyo TX-NR7100 from Amazon for $625. Other retailers (e.g.Best Buy) advertise it for up to $1200, so Amazon's price is outstanding. Set up was far more complicated (for me) than any previous receiver that I ever owned, mostly because there were a very large number of back panel input and output jacks, to and from the TV, as well as speaker outputs for 9.2 surround. Suffice it to say that once everything was connected properly (I made a few mistakes along the way), I was completely thrilled. The On Screen Display, completely accessible either from the front panel or the remote was far superior to anything I had ever seen before. Literally every operating parameter is accessible to the user. And I used most of them. It is also completely WiFi ready so my 150 Gbit home Wifi network lets it connect wirelessly and stream music error free. BlueTooth is also another way to connect almost any device to it for audio and audio/video playback if you connect the digital connections to and from a modern TV. It also speaks and listens to Alexa, although I must confess that I haven't played around with that much yet. This is already much longer than I had intended, so let it suffice to say that the Onkyo TX-NR7100 is an absolutely incredible receiver for an incredible price. I'd give it 8 stars if I could. JM TEPPER
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 7, 2024
B
Verified Purchase
Brian M.
Lake Worth, US
★★★★★ 5
Sounds great.
Just received my Onkyo TX-NR 7100, watched a few YouTube videos before it arrived, so set up was easy. Ran accuEQ, I am getting new front speakers so I’ll wait to run Dirac. After accuEQ, I still had to make a few adjustments, to the speaker levels and especially the sub. It set my subwoofer way too low. As of right now having no problems with Bluetooth. I’ve only listened to music so far, can’t wait to watch a movie. For now I have a 5.1.2. System, getting new fronts, the Klipsch r51-m’s will go to the rear surround and Klipsch r41-m’s will be my height speakers in a 5.1.4 system. So far loving this avr. Update 2: Just calibrated with Dirac for the 6th time. They tell you if you sit in a recliner, reclined measure with it reclined. Well I measured with the chair in its upright position. It makes a huge difference I hear the surrounds much better. Btw I listen to all channel stereo, I know audiophiles say it sucks, however I listened to 2 channel stereo for 20 years, when there was nothing else. I didn’t buy a 9 channel avr to listen to 2 channel stereo. Like Randy the cheap audio man says “ audiophiles aren’t always right. If it sounds good to you, that’s all that matters.” So try calibrating in the upright position, or if you sit on a stationary chair or couch, try positioning the mic slightly forward of your listening position. It makes a huge difference. Hope this helps, enjoy. Update: Ok bought Klipsch rp-600m speakers for the front with 52c center. 51m surrounds, 41m rear heights. Polk owm3 front heights. Why Polk? Lighter easy to hang and as height speakers they are only there for atmos. Ran Dirac live, the application does what it would take several hours to make it sound like it does, if I even could get it to sound so good. Apple TV 4K with my Hisense U8K. The google tv interface is ok, but Apple TV is faster and easier. The Onkyo 7100 is a gem, runs pretty warm but I have it out in the open. If you are going to put in a cabinet I suggest a fan. Very happy with the whole system.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 11, 2025
A
Verified Purchase
Amazon Customer
Lexington, US
★★★★★ 5
Straightforward setup Excellent Warm sound
Style: AVR-S770H
Setup was surprisingly easy. No manual included, but a quick link to a PDF. Connection to PC, Nintendo Switch, Cable Box done in minutes. Setup Menu worked great. Bluetooth pairing to phone easy. Setup as 5.1 (waiting on 2 more speakers for 7.1 connection). Small glitch in that the speakers didn't respond or even test tone right away. Went in and out of menu a few times, and then they worked (did this once with a 2-speaker quicker setup and then did the same glitch when adding the additional speakers to the profile with the full 5.1 setup). Works with ARC well (Samsung TV that came with silly external box) and reciever connection defaults to a passthrough when not on, which is nice. Video is great and compressed audio cleanup works well. Didn't do Mic leveling yet, but the manual speaker tuning worked well at leveling things out for 5.1. I was expected a lot harder set-up and was pleasantly surprised. It's a quality product. Some folks may not like the direct DB volume adjustment but I find it handy, especially when working a little later at night, I can dial in a very exacting low volume so as not to disturb the rest of the house. Very happy with purchase.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2024
G
Verified Purchase
GMTTD
Draper, US
★★★★★ 5
Great product
Style: AVR-S770H
I have owned several $1000.00 plus theater systems of 7.1(2) channels and I have never heard my speakers put out the sound like the Denon does. I would never change systems again unless Denon stops producing this product
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026

recommand products