Pay in installments of $62.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 19 - Jul 24
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
VHL GST Tag Protein, HumanProduct Specification Species Human Synonyms VHL, Von Hippel Lindau Tumor Suppressor, VHL1, E3 Ubiquitin Protein Ligase Accession P40337 Amino Acid Sequence Met1 Asp213, with N terminal GST tag
Product Specification
| Species | Human |
| Synonyms | VHL, Von Hippel-Lindau Tumor Suppressor, VHL1, E3 Ubiquitin Protein Ligase |
| Accession | P40337 |
| Amino Acid Sequence | Met1-Asp213, with N-terminal GST tag MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKMPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD |
| Expression System | E.coli |
| Molecular Weight | 50kDa |
| Purity | >85% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | GST Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles. |
| Reference | 1、Pause A. et al. (1997) The von Hippel-Lindau tumor-suppressor gene product forms a stable complex with human CUL-2, a member of the Cdc53 family of proteins. Proc Natl Acad Sci U S A. 94(6):2156-2161. |
Background
Von Hippel-Lindau disease tumor suppressor (VHL) is a component of a ubiquitination complex, and involved in the ubiquitination and degradation of hypoxia-inducible-factor (HIF). Von Hippel-Lindau (VHL) disease, an autosomal dominant disease that can predispose individuals to multiple neoplasms, is characterized by heterozygous germline mutation in VHL gene on chromosome 3p. Germline pathogenic variants in the VHL gene predispose individuals to specific types of benign tumors, malignant tumors, and cysts in many organ systems. Mutation or transcriptional silencing of the VHL gene and subsequent loss of the remaining VHL allele are associated with sporadic, clear cell renal carcinoma, CNS hemangioblastomas, and other VHL-associated tumors, which make it a bona fide tumor-suppressor gene.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy