Pay in installments of $21.25 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Sep 18 - Sep 23
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human BCMA/TNFRSF17 Protein, His TagProduct Specification Species Human Synonyms Tumor necrosis factor receptor superfamily member 17, B cell maturation protein, CD269, BCM, BCMA Accession Q02223 1 Amino Acid Sequence Protein sequence (Q02223 1, Met1 Ala54, with C His Tag) MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA Expression System HEK293 Molecular Weight Predicted MW: 5. 9 kDa Observed MW: 10, 13 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Physical
Product Specification
| Species | Human |
| Synonyms | Tumor necrosis factor receptor superfamily member 17, B-cell maturation protein, CD269, BCM, BCMA |
| Accession | Q02223-1 |
| Amino Acid Sequence | Protein sequence (Q02223-1, Met1-Ala54, with C-His Tag) MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA |
| Expression System | HEK293 |
| Molecular Weight | Predicted MW: 5.9 kDa Observed MW: 10, 13 kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Physical Appearance | Lyophilized powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 with 3% trehalose. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. |
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy