SKU: 98067114307

Human Fas/CD95, His tag

Sale price$121.50 Regular price$135.00
Save 10%

Pay in installments of $33.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 21 - Sep 26

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Fas/CD95, His tagProduct Specification Species Human Synonyms Apo 1 antigen, Apoptosis mediating surface antigen, FAS, FASLG receptor, APT1, FAS1, TNFRSF6 Accession P25445 Amino Acid Sequence Protein sequence (P25445, Met1 Asn173, with C 10*His) MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNGGGGSHHHHHHHHHH Expression System HEK293 Molecular

Product Specification


Species Human
Synonyms Apo-1 antigen, Apoptosis-mediating surface antigen, FAS, FASLG receptor, APT1, FAS1, TNFRSF6
Accession P25445
Amino Acid Sequence

Protein sequence (P25445, Met1-Asn173, with C-10*His) MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 21 kDa Observed MW: 25-40 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

The Fas receptor, also known as Fas, FasR, apoptosis antigen 1 (APO-1 or APT), cluster of differentiation 95 (CD95) or tumor necrosis factor receptor superfamily member 6 (TNFRSF6), is a protein that in humans is encoded by the FAS gene. Fas was first identified using a monoclonal antibody generated by immunizing mice with the FS-7 cell line. Thus, the name Fas is derived from FS-7-associated surface antigen. The Fas receptor is a death receptor on the surface of cells that leads to programmed cell death (apoptosis) if it binds its ligand, Fas ligand (FasL). It is one of two apoptosis pathways, the other being the mitochondrial pathway.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 98067114307

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 14 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
Laura
San Leandro, US
★★★★★ 5
Great quality Coach Bag!!
Size: One Size, Color: B4/Maple Maple
Coach Tabby 20: Great small bag with lots of individual compartments...for a wallet, phone, comb, keys, earbuds, & lip gloss. The color is a medium dark brown with a lighter brown highlighting Coach signature...it goes with everything! I especially like the expandable shoulder strap to crossbody wear, with plenty of room to have it hang long if you like...and not have the strap only go to your side when wearing it crossbody...it actually can go to my hip and I am 5'6'. I've received complements on it...one I especially liked was a young girl cashier, who looked at it with big eyes, smiled and said, "Cute Bag!". I'm in my early 60's so that felt kinda great!!! ;) I bought on Amazon because Amazon speed delivers!! Thank you Amazon!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 3, 2025
R
Verified Purchase
Rawle Bhaggan
Whiting, US
★★★★★ 5
Comfort Meets Performance — Nike Men’s Journey Run Road Running Shoes
Size: 10.5, Color: Black/Summit White/Anthracite/Cyber
I picked up the Nike Men’s Journey Run Road Running Shoes on a whim, and they turned out to be a great surprise. From the first wear, they felt comfortable and lightweight, with cushioning that makes walking and running on pavement much easier on the feet. They don’t feel overly stiff or bulky, which I appreciate for everyday use. What I like most is how versatile they are. I’ve worn them for short runs, gym workouts, and even casual outings, and they’ve held up well in all situations. The fit is true to size, and the upper feels breathable enough to stay comfortable throughout the day. They also have a clean, simple look that pairs well with both athletic and casual clothes. Traction has been solid on roads and sidewalks, and I haven’t noticed any slipping, even on slightly wet surfaces. While they may not be designed for competitive racing, they’re perfect for daily training, walking, or anyone looking for a reliable, comfortable running shoe. Overall, the Nike Journey Run shoes offer good comfort, dependable performance, and everyday style. A solid choice if you want a no-nonsense running shoe that you can wear beyond just your workouts.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 22, 2025
D
Verified Purchase
Dayan
Los Angeles, US
★★★★★ 5
Versatile sneakers. The upper makes the difference.
Size: 11, Color: Black/Smoke Grey/Medium Ash
Very good quality shoes for this price. My impressions: 1. The Flyknit upper feels very soft and comfortable. I don't get the rough, scratchy feel of some lower-quality options. It also disperses heat very well. 2. The midsole is firm, but not overly hard. I find it well-balanced, as it has good shock absorption while still being soft enough to cushion the soles of my feet. 3. They're versatile. For me, especially the black ones with the dark gray sole, they work for casual wear, going to the gym, walking, and short, light runs. 4. I consider them very decent shoes for walking and short runs under 5k.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 9, 2025
K
Verified Purchase
Kelly L. MacDonald
Louisville, US
★★★★★ 5
Offer lots of support and traction- perfect gym shoes
So comfortable- they offer a lot of support and I can tell they will last for a long time (and I’m hard on my gym shoes!). I’m actually a female but I sized down and they fit perfectly. I found them on sale and definitely recommend them as they are well worth the price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 5, 2026
T
Verified Purchase
Thomas Aycock
San Leandro, US
★★★★★ 5
Comfortable nike running shoes.
Size: 13, Color: Black/Summit White/Anthracite/Cyber, Size: 13, Color: Black/Summit White/Anthracite/Cyber
Nice and comfortable from the moment that I put them on my feet. Feels like you’re walking on memory foam. You have to buy comfortable shoes when you’re on your feet all day. I do Amazon Flex in. These will be perfect although I have several pairs so that way, the shoe lasts longer. Definitely would buy these in different colors very satisfied.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 29, 2025

recommand products