SKU: 97937623322

Apolipoprotein A-I/APOA1 Protein His Tag, Human

Sale price$121.50 Regular price$135.00
Save 10%

Pay in installments of $33.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 24 - Aug 29

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Apolipoprotein A-I/APOA1 Protein His Tag, HumanProduct Specification Species Human Synonyms Apolipoprotein A I, Apo AI, ApoA I, Apolipoprotein A1, APOA1; Apolipoprotein A I, Apo AI, ApoA I, Apolipoprotein A1, APOA1 Accession P02647 Amino Acid Sequence Asp25 Gln267, with N 6*His

Product Specification


Species Human
Synonyms Apolipoprotein A-I, Apo-AI, ApoA-I, Apolipoprotein A1, APOA1;Apolipoprotein A-I, Apo-AI, ApoA-I, Apolipoprotein A1, APOA1
Accession P02647
Amino Acid Sequence Asp25-Gln267, with N-6*His MHHHHHHDDDDKDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ.
Expression System E.coli
Molecular Weight 29.6 kDa
Purity

>98% by SDS-PAGE and RP-HPLC

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris-HCl, 100mM NaCl, pH8.0
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

Apolipoprotein A-I/APOA1 mainly exists in high density lipoprotein (HDL) particles, which can prevent excessive accumulation of cholesterol in macrophages, form foam cells, deposit on the arterial wall, and cause atherosclerosis. The main function of APOA1 is to activate lecithin cholesterol acyltransferase (LCAT) in HDL complex, catalyze cholesterol esterification, and then dissolve more cholesterol-HDL complex, increase the cholesterol transport capacity of HDL particles and the ability of liver to metabolize cholesterol. Therefore, APOA1 is an important marker to evaluate the ability of blood cholesterol clearance.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 97937623322

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 20 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
MamaRagu
Lake Worth, US
★★★★★ 4
Pretty nice blanket
First off I have to say that this is not exactly a cooling blanket. It is true that when you first get under it, it does feel cool. Shortly thereafter though, wherever the blanket makes contact with you it warms up to your body temperature, so it doesn’t remain cool. Still, I just moved my foot to a different area and hit a cool pocket, so it has its moments. I have to say I really like the weight of this blanket. It’s so hard to find a good blanket, that is not that thick, It is thin, which is exactly what I was looking for since I live in Florida. One side of the blanket is the “cooling“ side which is plain gray, and on the other side is a gray and white striped pattern. I’m not really crazy about the pattern to be honest. I wish this blanket came in more colors or patterns. The blanket fit my queen bed nicely - not too big or too small. For what it is, I’m not really sure I would say it’s good value for the money, but I do like this blanket.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 20, 2026
S
sierra
Massapequa, US
★★★★★ 5
Surprisingly, effective cooling blanket
When I first saw this cooling blanket available, I grabbed one right away. I had purchased a cooling blanket for my grandfather last summer that was fantastic but very expensive, so I was curious whether this one would actually compare considering the price difference. Right out of the package, I could immediately feel that it was different from a normal comforter. The fabric itself feels noticeably cool when you touch it, which honestly caught me off guard in a good way. The gray version I have features a striped design on one side and a solid gray color on the reverse. I love that it isn’t just plain white like so many cooling blankets tend to be. The pattern adds some visual interest while still matching pretty much any bedroom setup. The fabric is incredibly soft and smooth against the skin. The brand says it’s made with Ice Toweling technology fabric, which supposedly works by absorbing body heat through the fibers’ molecular structure. I’m not totally sure how that works scientifically, but I can definitely tell you the result is real because the blanket does feel cooler when you sleep under it. Something else I appreciate is that despite being silky smooth, it doesn’t constantly slide off the bed. I was expecting it to behave like a satin sheet, but it actually stays in place surprisingly well and its true to size. Cleaning is straightforward. They recommend air drying the blanket to preserve the cooling fibers, which seems like a reasonable precaution. I would probably treat it like a delicate fabric just to keep it in good shape long term. All things considered, I’m really impressed with this blanket. It’s soft, comfortable, genuinely cooling, and a great value compared to some of the pricey alternatives out there. If you tend to overheat while sleeping, this is definitely worth considering.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 9, 2026
N
Verified Purchase
Nicole Ramirez
Bozeman, US
★★★★★ 5
Great pillow
Style: Side Sleeper, Pattern Name: King
Love them, very fluffy and full not flat like my old pillows. And they are easy to fluff even if they go flat after sleeping on them
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 17, 2024
J
Verified Purchase
Julielle
Charlottesville, US
★★★★★ 5
Really helped with my neck pain
Style: Side Sleeper, Pattern Name: King
These were exactly what I was looking for. Really helped with my neck pain.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 21, 2026
C
Verified Purchase
Cecilia
Draper, US
★★★★★ 4
Great Pillows
Style: Side Sleeper, Pattern Name: King
I was very skeptical about purchasing pillows online. After much research, I decided to buy two of the king size pillows. When they arrive, they were rolled up tightly in plastic. I fluffed them up and got new pillow cases for them. The first few days, I was tossing and turning. After giving them a few days, I can honestly say they are very nice pillows. Not to firm and not to soft...a very nice medium! They have a cool feeling when you lay on them. These pillows are great for those who sleep on their back AND side sleepers. No feathers have been poking out. My significant other LOVES these pillows. Been sleeping great and feel like I made a great decision getting these. Great value, great materials and great quality. I highly suggest trying these out if you're looking to replace your pillows.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 10, 2022

recommand products