SKU: 97036150944

Human ECP/Ribonuclease 3 Protein, His Tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 21 - Aug 26

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human ECP/Ribonuclease 3 Protein, His TagProduct Specification Species Human Synonyms Eosinophil cationic protein, RNase 3, RNS3 Accession P12724 Amino Acid Sequence Protein sequence (P12724, Arg28 Ile160, with C His Tag) RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI Expression System HEK293 Molecular Weight Predicted MW: 17. 2 kDa Observed MW: 25 35 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation

Product Specification


Species Human
Synonyms Eosinophil cationic protein, RNase 3, RNS3
Accession P12724
Amino Acid Sequence

Protein sequence (P12724, Arg28-Ile160, with C-His Tag) RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI

Expression System HEK293
Molecular Weight Predicted MW: 17.2 kDa Observed MW: 25-35 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Ribonuclease 3, commonly known as Drosha, is a Class 2 ribonuclease III enzyme crucial for microRNA (miRNA) biogenesis. Located in the nucleus, it functions as the core catalytic component of the Microprocessor complex. Its primary role is to initiate miRNA processing by cleaving long primary miRNA transcripts (pri-miRNAs) into approximately 70-nucleotide precursor miRNAs (pre-miRNAs). This precise endonucleolytic cleavage is the first and essential step in the miRNA maturation pathway, which ultimately regulates gene expression post-transcriptionally. Dysregulation of Drosha is implicated in various cancers and developmental disorders.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 97036150944

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 26 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Anne Erwin
Lexington, US
★★★★★ 5
Beautiful shelves!
Color: Dark Walnut, Size: 8.5inch(2PCS)
Exactly what I needed! Very easy to install and looks great! Great value for the money.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 19, 2026
R
Verified Purchase
ron shaffer
Carnegie, US
★★★★★ 5
Great value
Color: Natural Wood, Size: 8.5inch(2PCS)
Excellent, solid built shelves. Comes with every type of fastener you could possibly need to install. Even comes with a small level. Very impressed with it all and highly recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 24, 2026
D
Verified Purchase
D.O.
Lake Worth, US
★★★★★ 4
Nice shelf, install a bit problematic
Color: Dark Walnut, Size: 8.5inch(2PCS)
Nice little shelf, looks great, feels stable enough for my small accent lamp. Two issues: 1. The cutout in the corner is perfect for a cord >>>BUT<<< the plug itself CANNOT fit though that hole. You have to feed the cord through BEFORE INSTALL. So once it’s in, it’s IN. 2. Install seems pretty straight forward but it was not so easy! The rails are too thick for a pencil to go through the screw hole to mark placement. I had to physically hold everything in place and leveled WHILE I drilled. Rather annoying.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 12, 2026
A
Verified Purchase
Amazon Customer
Natrona Heights, US
★★★★★ 5
Great item!
Color: Natural Wood, Size: 8.5inch(2PCS)
These shelves were great! I put them in the bathroom and helped with added space for holding candle and items to help keep counter clear.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 9, 2026
S
Verified Purchase
sgtfergsgirl
Whiting, US
★★★★★ 5
Good quality
Color: Dark Walnut, Size: 11.2inch(2PCS)
These were the perfect fit, and they came with all the necessary hardware. We like them so much that we bought a different size for another room in our house, and they were perfect as well. They are a very nice quality wood. It's not that cheap stuff that will fall apart.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 19, 2025

recommand products