SKU: 96542927932

Human 14-3-3 beta, His tag

Sale price$175.50 Regular price$195.00
Save 10%

Pay in installments of $48.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 22 - Jul 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human 14-3-3 beta, His tagProduct Specification Species Human Synonyms Protein 1054, Protein kinase C inhibitor protein 1 (KCIP 1) Accession P31946 Amino Acid Sequence Protein sequence (P31946, Met1 Asn246, with C 10*His)

Product Specification


Species Human
Synonyms Protein 1054, Protein kinase C inhibitor protein 1 (KCIP-1)
Accession P31946
Amino Acid Sequence

Protein sequence (P31946, Met1-Asn246, with C-10*His) MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGENGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Predicted MW: 29.8 kDa Observed MW: 30 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

14-3-3 protein beta/alpha is a protein that in humans is encoded by the YWHAB gene. This gene encodes a protein belonging to the 14-3-3 family of proteins, members of which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals. The encoded protein has been shown to interact with RAF1 and CDC25 phosphatases, suggesting that it may play a role in linking mitogenic signaling and the cell cycle machinery. Two transcript variants, which encode the same protein, have been identified for this gene. It has been documented to regulate various cellular processes, including cell proliferation, signal transduction, cell cycle and apoptosis. Downregulation of YWHAB has been reported to impart suppressive effects on the proliferation of cervical and gastric cancer cells. Additionally, YWHAB was previously found to be upregulated in colon cancer cells, which is in turn associated with poorer prognosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 96542927932

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
V
Verified Purchase
Vivian
Dallas, US
★★★★★ 5
Love it.
Color: Bunny (Beige), Size: Large
Good quality and well worth the price. My dog loves it. The squeaky part is fun, and the crinkly, tear-resistant paper in the ears makes playtime even more exciting.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026
O
Verified Purchase
Odalis Perez
Fort Morgan, US
★★★★★ 5
Good for small breeds and fun!
Color: Multi Squeaker Balls, Size: X-Small, Style: 4-Pack
I’m glad I found these for my 6 month puppies they absolutely love them super fun to play with. Although, the surface has come off due to my puppies biting it off. Look at the sizes as they have a few!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2026
O
Verified Purchase
Olga
Chelsea, US
★★★★★ 5
A lot of fun for dogs
Color: Multi Squeaker Balls, Size: Large, Style: 4-Pack, Color: Multi Squeaker Balls, Size: Large, Style: 4-Pack
My dogs love it a lot. Balls don't fall off the balcony - good size. Great sound which catches dogs attention . Colorful . Good quality.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
J
Verified Purchase
Jarrett Austin pirtle
Port Orchard, US
★★★★★ 5
👍🏼
Color: Multi Squeaker Balls, Size: Medium, Style: 4-Pack
This dog squeak ball has been a big hit in my home and keeps my dog entertained for long periods of time. The squeaker really grabs their attention and encourages play, tapping into their natural instincts to chase and fetch. My dog especially loves how it bounces and squeaks, making it perfect for both indoor and outdoor play. It’s lightweight and easy for them to carry around, even for quick games of fetch in the yard. In terms of durability, it has held up pretty well so far. The squeaker may not last forever with heavy use, but the ball itself still stays in good shape. Overall, it’s a fun, engaging toy that keeps my dog active and happy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2026
P
Verified Purchase
Precise Disarray
Alexandria, US
★★★★★ 4
budget friendly for dogs who lose balls in the creek
Color: Multi Squeaker Balls, Size: Medium, Style: 4-Pack
Not great quality, but works for our needs. I have a ball crazy lab. She loves for me to throw a ball using the Chuck-it Ball Launcher. We do this in our wide back yard that butts up to a creek. At some point during her run and fetch, she will take a quick detour right into the creek. She nearly always still has the ball, but once in awhile it is lost. Not wanting to chance it on more pricy (and more durable) balls, I get these or something like these. They dont cost much, yet they do the job. I' not upset if one gets sacrificed to the creek waters and mud. Since the balls end up getting wet often, they will kinda fall apart over time (chasing, kicking, throwing, retrieving, dog saliva etc). But she doesn't chew on them. Glad she doesnt as tennis balls arent good on teeth, but even if it was ok, the balls probably would be breached easily. SO get these if you are like me and want a ball that does the job but arent a total financial loss if get lost or destroyed. For indoor play we and by we I mean our 3 dogs demand that we use the rubbery max glow chuck-it ball. And will ignore this style ball. Yes, I am well trained. lol
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 11, 2024

recommand products