SKU: 96005645602

CD39 His Tag Protein, Mouse

Sale price$522.00 Regular price$580.00
Save 10%

Pay in installments of $145.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 25 - Aug 30

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD39 His Tag Protein, MouseProduct Specification Species Mouse Synonyms Ectonucleoside triphosphate diphosphohydrolase 1, ENTPD1, NTPDase 1, Ecto ATPDase 1 Accession P55772 1 Amino Acid Sequence Thr38 Ile478, with C terminal 8*His

Product Specification


Species Mouse
Synonyms Ectonucleoside triphosphate diphosphohydrolase 1, ENTPD1, NTPDase 1, Ecto-ATPDase 1
Accession P55772-1
Amino Acid Sequence

Thr38-Ile478, with C-terminal 8*His

TQNKPLPENVKYGIVLDAGSSHTNLYIYKWPAEKENDTGVVQQLEECQVKGPGISKYAQKTDEIGAYLAECMELSTELIPTSKHHQTPVYLGATAGMRLLRMESEQSADEVLAAVSTSLKSYPFDFQGAKIITGQEEGAYGWITINYLLGRFTQEQSWLSLISDSQKQETFGALDLGGASTQITFVPQNSTIESPENSLQFRLYGEDYTVYTHSFLCYGKDQALWQKLAKDIQVSSGGVLKDPCFNPGYEKVVNVSELYGTPCTKRFEKKLPFDQFRIQGTGDYEQCHQSILELFNNSHCPYSQCAFNGVFLPPLHGSFGAFSAFYFVMDFFKKVAKNSVISQEKMTEITKNFCSKSWEETKTSYPSVKEKYLSEYCFSGAYILSLLQGYNFTDSSWEQIHFMGKIKDSNAGWTLGYMLNLTNMIPAEQPLSPPLPHSTYIGGGSGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 72-90kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

CD39 is also known as Ectonucleoside triphosphate diphosphohydrolase 1, ENTPD1, NTPDase 1, Ecto-ATPDase 1, in the nervous system, could hydrolyze ATP and other nucleotides to regulate purinergic neurotransmission. Could also be implicated in the prevention of platelet aggregation by hydrolyzing platelet-activating ADP to AMP. Hydrolyzes ATP and ADP equally well. NTPDase-1 was originally described as CD39, a B lymphocyte cell surface marker, but it is also present on the surface of natural killer cells, T cells, and some endothelial cells. Regulatory T cells (Tregs) mediate immunosuppression through multiple, non-redundant, cell-contact dependent and independent mechanisms, a growing body of evidence suggests an important role for the CD39-CD73-adenosine pathway. CD39 ectonucleotidase is the rate-limiting enzyme of a cascade leading to the generation of suppressive adenosine that alters CD4 and CD8 T cell and natural killer cell antitumor activities.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 96005645602

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Alex
Port Orchard, US
★★★★★ 5
Our Pit Bull’s Favorite Toy!
Color: A-Navy, Color: A-Navy
We absolutely love this MAXBECK bear toy! We’ve ordered it 4 times over the last 8 months because our senior pit bull is obsessed with his “babies.” He always has one close to him and even cuddles with them. The material is very sturdy and holds up amazingly well even with rough play. My dog’s favorite part is the squeaker. What I love most is that even after he finally tears into it, the rope built inside becomes a whole second toy for him and keeps the fun going. If you have a heavy chewer who destroys toys quickly, this one is definitely worth trying!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2026
M
Verified Purchase
MEV
Houston, US
★★★★★ 3
Not indestructible
Color: C-Navy+Oak, Color: C-Navy+Oak
I assume it is probably hard to create an indestructible product, but my puppy had it apart in no time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 10, 2026
N
Verified Purchase
Nirpno
Lowell, US
★★★★★ 2
NOT DURABLE, LONG-LASTING, OR USEFUL
Color: A-Navy, Color: A-Navy
I gave this dog toy 2-stars based on my dog toy rating system (DTRS) for “Albert” the Blue Bear! Safety (1-rating): Albert fell apart after 4-hours of use. 1. The ears were chewed off and I was only able to find one of them, which means my dog swallowed the other ear. Very big concern as it depends on how big your dog is to pass this object. The ear is about the size of 1.5-quarters. 2. The tail was almost chewed off entirely and was hanging on by a thread before I threw it out. 3. After the ears came off, the inside foam started to come out, which raised my concern for my dog’s saftey. 4. The entire body was soft and did not cause any harm to teeth, gums, paws, nose, etc. Durability (3-rating): 1. The ears and tail are the weakest parts of Albert as they can easily be chewed off. 2. The body is durable enough to sustain 4-hours of use, as I threw Albert out after the ears and tail were torn off within 4-hours. 3. The small squeaker inside Albert’s belly was broken after 15-minutes of use. Thank Goodness! 4. My next concern was how long the arms and legs would last; TBD! Squeaker (1-rating): 1. Small plastic squeaker, the size of a half-dollar, with a high pitched noise. Fatality (2-rating): 1. Albert was put to rest after 4-hours of use as I was concerned for the safety of my dog with continued use. 2. If Albert didn’t come with ears or a tail, I can only imagine how long he would’ve survived as the material seemed to be durable enough to withstand continued use. In conclusion, “Albert” the Blue Bear is not worth the money for a toy that falls apart after 4-hrs of use and with the concerns of safety. I was surprised that it was only 8-inches tall, next time I’ll confirm the size of the toy before I purchase the next one. About my dog “Cannoli” for comparison: Breed: Blue Healer / Lab mix Weight: 40-lbs Energy Level: High Age: 7-months Chew Rating: Aggressive
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 20, 2025
S
Verified Purchase
Steven D'Arcangelo
Grantham, US
★★★★★ 3
The dog won!
Color: A-Navy, Color: A-Navy
It’s not indestructible. Wonder if I can get a refund or another toy. It did last longer than most so I give them credit for that!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
H
Verified Purchase
Heidi fishel
Bozeman, US
★★★★★ 5
Almost good enough
Color: E-Navy+Purple
My dog chewy can rip through anything, even these. I do love the toys they’re great. They’re made with coconut on the inside, but could somebody please!, make a chew toy worthy of my dogs teeth, cause this ain’t it. But it is the strongest so far . I would recommend it. My doodle chewy short for Chewbacca is insane about chewing.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 9, 2026

recommand products