SKU: 94205070077

Human GM-CSF, His tag

Sale price$45.00 Regular price$50.00
Save 10%

Pay in installments of $12.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 17 - Sep 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human GM-CSF, His tagProduct Specification Species Human Synonyms Granulocyte macrophage colony stimulating factor, Colony stimulating factor (CSF), Molgramostin, Sargramostim Accession P04141 Amino Acid Sequence Protein sequence(P04141, Ala18 Glu144, with C 10*His) APARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQEGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 16. 1kDa

Product Specification


Species Human
Synonyms Granulocyte-macrophage colony-stimulating factor, Colony-stimulating factor (CSF), Molgramostin, Sargramostim
Accession P04141
Amino Acid Sequence

Protein sequence(P04141, Ala18-Glu144, with C-10*His) APARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQEGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

Theoretical:16.1kDa Actual:17-30kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Granulocyte-macrophage colony-stimulating factor (GM-CSF), also known as colony-stimulating factor 2 (CSF2), is a monomeric glycoprotein secreted by macrophages, T cells, mast cells, natural killer cells, endothelial cells and fibroblasts that functions as a cytokine. Unlike granulocyte colony-stimulating factor, which specifically promotes neutrophil proliferation and maturation, GM-CSF affects more cell types, especially macrophages and eosinophils. It is part of the immune/inflammatory cascade, by which activation of a small number of macrophages can rapidly lead to an increase in their numbers, a process crucial for fighting infection.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 94205070077

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 14 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
karine
Belleville, US
★★★★★ 5
Works
Size: 3 Panel-102'', Color: Beige, Size: 3 Panel-102'', Color: Beige
It’s beige and not white. Once install - hard to disinstall. Need a drill to put it together
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
R
Verified Purchase
ralversity
Carnegie, US
★★★★★ 3
Does the job, but assembling by yourself is a nightmare
Size: 4 Panel-88'', Color: Black
Does it do the job? Yes, although as others said there are small gaps but it's not a huge deal. The price is also good. But the reason I'm giving it a 3/5 is simply because the assembly for this was a complete nightmare. I honestly don't think I would recommend this to anyone unless they have another person to help them assemble it, because doing it by myself was terrible. I don't think I'd buy this again, I think I'd opt to just spend a bit more money and save myself the trouble personally.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
T
Verified Purchase
Talagand
San Leandro, US
★★★★★ 4
Reasonably adequate room divider
Size: 4 Panel-88'', Color: Beige
I'm reviewing this as I assemble it. Couple things: 1. I didn't expect as much assembly. I've ordered dividers before and they more-or-less came as one unit. Sometimes the panels needed screwing together. These require complete assembly and come largely as three rods: two make up vertical columns and snap together. Another one (called part "C") makes the horizontal columns and you have two of these per panel (one attaches to part "A" and the other part "B"). These parts are metal with a plastic shim. Using the wood screws to attach to part "C" is a real pain in the neck. There's not much holding the panel in place so it's a little tricky. One tactic I've found while I'm assembling that works for the initial connections from parts A and B to their respective "C" rods is to hold the screw in place with a screw driver and then rotating the rod around the screw. This will do a number on your hands if you aren't wearing gloves. This obviously doesn't work when completing the connection. Using a driller driver on this is really near impossible because there isn't anything you can use to secure it in place. You can use it on the first panel, but as it gets longer, it becomes increasingly difficult and because it isn't wood, it's really tight. I considered drilling larger pilot holes but since there are only 4x4=16 screws I need to screw in, I just decided to use my screw driver to complete it. 2. Also related to assembly. When completing the panels (attaching parts "A" and "B" to parts "C" that have the cloth cover on it), you have to be careful that when you tighten that side that it isn't loosening the other side. Because the pilot holes are so tight, you can end up rotating the rod, which rotates it in the same direction as looser on the original side. Having someone hold the "C" rod in place while you screw it in is probably the easiest approach. I didn't have a 2nd person, so I just had to keep flipping back and forth and tightening both sides as I screwed it in. Not the worlds biggest deal, but annoying nonetheless. 3. The way the instructions are written, they seem to suggest building this thing progressively; that is, you do panel 1, then 2, connect them together, then do 3 and connect it, etc. I took a different route that I suspect saved me quite a bit of trouble, and I assembled all four panels first and THEN connected everything together. 4. For the love of God make sure you check that the plastic tip is on the same side for every panel. Otherwise, you have to take one side apart again and reverse it. On the bright side, if this happens, you've essentially bored out the pilot holes to be the correct size... which is having me question if I shouldn't have just bored them out to the appropriate width in the first place. 5. Attaching all of the panels together is also an enormous pain in the ass unless you happen to have an 88" long elevated surface. Attaching the legs either requires you to elevate one side, which will invariably twist the inexplicably cheap material in the bottom connectors... or you can attach them sideways... or you can put this thing upright, having two people hold the panels in place while you use the allen wrench to tighten the bolts on the underside. None of those are particularly great options. NOW on to the utility itself. 1. The panels do let some light through (I didn't believe their advertising, and that was one of the reasons that I bought beige, is that I wanted it to not be too dark). They aren't transparent though, so it isn't that far off from their description. They functionally work great, and keep the mess of wires hidden and when I'm sitting at my desk, actually reflect quite a bit of light into my office. Great! 2. My wife has described these as "the most hideous piece of furniture ever conceived of by man." So it does not have spouse approval factor. Granted, she will seldom be in my office area, so that isn't the end of the world. 3. These are really hard to align in a way that doesn't look a little tacky. There are some plastic connectors but they don't do a bang up job of keeping these in place. Each panel is slightly tilted and it's... quite obvious. I may at some point make my own improvements to these to help make them more level. It's not a particularly expensive product so I wasn't expecting much so it's fine and I'm not going to ding them on the rating because of it. All said, would I buy this product again? Probably not. It's assembly was ~90 minutes which is about 75 minutes longer than I was anticipating spending on this (not including the 5 minute writeup that I'm doing here). But am I going to return it? Also no, if for no other reason I'd be just as annoyed taking it apart and putting it in the original box to return it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 31, 2023
M
Verified Purchase
Matthew Sanganza
Natrona Heights, US
★★★★★ 5
Sturdy, Easy to Set Up, and Looks Great
Color: Grey, Size: 34" - 3 Panel
I’m really happy with this RANTILA 3-panel room divider. It was simple to set up, stands securely on its own, and gives plenty of privacy. The height is perfect, and the panels look clean and modern in my space. It’s lightweight enough to move around but still feels sturdy. Overall, a great divider that works exactly as I needed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 14, 2025
M
Verified Purchase
Margaret Johnson
Omaha, US
★★★★★ 5
Not 6 ft
Color: Grey, Size: 34" - 3 Panel
I bought this for filming my auditions. I am 5’4” .The height lists is 6 ft but the fabric only reaches 5’9 1/2 “! when I must film myself head to toe, the top bars are showing. It’s easy to set up. But when I film I must tilt my camera to keep the top bars out of frame which is not acceptable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 1, 2026

recommand products