SKU: 93469388086

FABP6 His Tag Protein, Human

Sale price$230.40 Regular price$256.00
Save 10%

Pay in installments of $64.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 21 - Aug 26

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FABP6 His Tag Protein, HumanProduct Specification Species Human Synonyms ILeal Lipid binding protein Accession P51161 Amino Acid Sequence Met1 Ala128, with N terminal 8*His MHHHHHHHHMAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA Expression System E. coli Molecular Weight 16kDa (Reducing) Purity 95% by SDS PAGE & RP HPLC Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance

Product Specification


Species Human
Synonyms ILeal Lipid-binding protein
Accession P51161
Amino Acid Sequence Met1-Ala128, with N-terminal 8*His MHHHHHHHHMAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA
Expression System E.coli
Molecular Weight 16kDa (Reducing)
Purity

>95% by SDS-PAGE & RP-HPLC

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris, 100mM NaCl, pH8.0
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

FABP6(ILeal Lipid-binding protein, ILBP) is a cytoplasm protein which belongs to the calycin superfamily and Fatty-acid binding protein (FABP) family. It binds mainly to bile acids that are reabsorbed in the ileum. Thus, mice lacking FABP6 do not exhibit a fatty acid metabolic phenotype but are protected against gallstone disease. FABP6 is a cancer-related protein that acts as an intracellular transporter of bile acid in the ileal epithelium. FABP6 may also play an important role in early carcinogenesis.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 93469388086

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 7 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
U
Verified Purchase
User123456
Battle Creek, US
★★★★★ 5
Amazing!
Color: Midnight Green
The Hamile Keyboard Case for iPad (11th & 10th Generation) is a practical accessory for turning your iPad into a more laptop-like setup. Designed with a detachable wireless keyboard and protective case, it’s aimed at students, professionals, and anyone who types frequently on their tablet. One of its most appealing features is the 7-color backlit keyboard, which makes typing easier in low-light environments while also adding a customizable, stylish look. The backlighting can usually be adjusted in brightness and color, making it both functional and fun to use. The keys are generally responsive and comfortable enough for everyday typing tasks like emails, notes, and document work. The case itself provides decent protection for the iPad, helping guard against scratches and minor bumps. It also holds the tablet at a stable viewing angle, which is useful for video calls, studying, or streaming. The wireless connection is typically simple to set up via Bluetooth, and the keyboard can be detached when not needed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
A
Verified Purchase
Ari Love
Houston, US
★★★★★ 5
No need to tap my Nails on the screen anymore!
Color: Pink, Color: Pink
Cute, convenient, and definitely needed! I use it every day to carry my emotional support device The keyboard case is sturdy, easy to use, and makes it so much more convenient to take my my girl everywhere. Extra added protection! (I’m clumsy and my iPad has fell quite a few times!) the keyboard works great, I typed a lot of emails and docs! Very happy with this purchase!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 5, 2026
A
Verified Purchase
Angela C
Belleville, US
★★★★★ 5
The blue is perfect!
Color: Navy Blue
The best quality iPad cover I have ever had. And the blue is so pretty!!!! The keyboard synced quickly and has soft keys.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026
A
Verified Purchase
arisa
Bozeman, US
★★★★★ 4
Great quality case, keyboard doesn’t work as intended
Color: Dark Cherry
Case is fine and good quality but the keyboard doesn’t work as intended. Bluetooth connects great but the keyboard is formatted incorrectly. For example, when I try to use a dash, it puts an apostrophe instead. I have no idea how to reformat it myself. I’d love just a replacement keyboard
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 31, 2026
M
Verified Purchase
Mia Thacker
Carnegie, US
★★★★★ 5
Worth it!
Color: Pink, Color: Pink
Great buy! Worth the money and the color is nice. The keyboard works, some buttons I haven’t figured out but for the most part it’s worth the purchase!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2026

recommand products