SKU: 92221628047

Human IL-12A, His tag

Sale price$166.50 Regular price$185.00
Save 10%

Pay in installments of $46.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 22 - Aug 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-12A, His tagProduct Specification Species Human Synonyms Cytotoxic lymphocyte maturation factor 35 kDa subunit (CLMF p35), IL 12 subunit p35, NK cell stimulatory factor chain 1 (NKSF1), NKSF1 Accession P29459 Amino Acid Sequence Protein sequence (P29459, Arg23 Ser219, with C 10*His)

Product Specification


Species Human
Synonyms Cytotoxic lymphocyte maturation factor 35 kDa subunit (CLMF p35), IL-12 subunit p35, NK cell stimulatory factor chain 1 (NKSF1), NKSF1
Accession P29459
Amino Acid Sequence

Protein sequence (P29459, Arg23-Ser219, with C-10*His) RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 24.2 kDa Observed MW: 35-45 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Interleukin-12 subunit alpha (IL-12 p35) is a protein that in humans is encoded by the IL12A gene. This gene encodes a subunit of the cytokine Interleukin 12 (IL-12) that acts on T and natural killer cells, and has a broad array of biological activities. The cytokine is a disulfide-linked heterodimer composed of the 35-kD subunit encoded by this gene, and a 40-kD subunit that is a member of the cytokine receptor family. This cytokine is required for the T-cell-dependent induction of interferon gamma (IFN-γ), and is important for the differentiation of both Th1 and Th2 cells. The responses of lymphocytes to this cytokine are mediated by the activator of transcription protein STAT4. Nitric oxide synthase 2A (NOS2A/NOS2) is found to be required for the signaling process of this cytokine in innate immunity.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 92221628047

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
mia lia
Waukegan, US
★★★★★ 5
Best non greasy moisturizing lotion ever!!
Size: 20.3 Fl Oz (Pack of 1), Size: 20.3 Fl Oz (Pack of 1)
This lotion is honestly probably one of the best lotions I’ve ever used. I used it for the first time today immediately after my shower and it’s the perfect consistency not too thick or thin.. not full of water either which is good because my skin absorbs instantly! Most lotions sit on my skin and make me greasy and sweaty afterwards. It also smells like HEAVEN. Chocolaty and a hint of vanilla! I won’t be buying any other lotion this now!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 14, 2026
K
Verified Purchase
Karly P.
Chelsea, US
★★★★★ 4
Great moisturizer
Size: 20.3 Fl Oz (Pack of 1), Size: 20.3 Fl Oz (Pack of 1)
This cream is a great alternative to the more expensive name brand creams. I have ordered this a few times and I feel like it does a wonderful job keeping my skin feeling soft, nourished and moisturized until the next time I shower. I do not feel as though my skin is greasy or oily after using this product. The cream does not feel thick or heavy on my skin. I am able to put a pair of pants on comfortably after using cream without feeling sticky. The cocoa butter scent is light and not over powering. There are parts of my body that I have to avoid with the cream because I do have eczema, but this is something I have grown up with and I am used to. I have purchased the cream twice, and unfortunately, the second time I bought it the pump top came a little bit destroyed (shown in photo). The product is still fully functional and will not determine from buying this again in the future!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026
C
Verified Purchase
Chillbilly
Fort Morgan, US
★★★★★ 5
Satisfied
Size: 20.3 Fl Oz (Pack of 1)
Great value. Lotion is non greasy - fast absorbing and will last thru handwashing, leaves skin revitalized and soft. The smell is not as pleasant as I would like and the bottle's size makes pumping difficult. But all in all it was a good buy and worth the cons.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2026
S
Verified Purchase
Sheni
Waukegan, US
★★★★★ 5
High Quality Cocoa Butter Lotion
Size: 20.3 Fl Oz (Pack of 1)
This feels amazing on the skin, and works for every skin type. The application is very simple, and it lasts a long time ! The fragrance is sooo nice, and is almost exactly the same as the Vaseline version (as advertised on the bottle!).
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026
P
Verified Purchase
Pumpy girl
Los Angeles, US
★★★★★ 3
Good lotion Bad pump
Size: 20.3 Fl Oz (Pack of 1)
Great lotion! But the pump won’t open :(((
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026

recommand products