Pay in installments of $33.75 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Sep 4 - Sep 9
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
IFN-γ His Tag Protein, HumanProduct Specification Synonyms IFN ,Immune Interferon,type II interferon,T cell interferon,MAF,IFNG,IFG,IFI,IFN gamma Accession P01579 Amino Acid Sequence QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQGGGGSHHHHHHHHHH. Expression System HEK293 Molecular Weight 18. 5 kDa (Reducing) Purity >95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag His Tag
Product Specification
| Synonyms | IFN-γ,Immune Interferon,type II interferon,T cell interferon,MAF,IFNG,IFG,IFI,IFN-gamma |
| Accession | P01579 |
| Amino Acid Sequence | QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQGGGGSHHHHHHHHHH. |
| Expression System | HEK293 |
| Molecular Weight | 18.5 kDa (Reducing) |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized powder |
| Storage Buffer | 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
IFN-gamma, the only member of type II interferon, is a soluble dimer cytokine secreted mainly by natural killer cells (NK) and natural killer T cells (NKT) when it functions in innate immunity. During antigen-specific immunity it is secreted by CD4 Th1 and CD8 cytotoxic T cells.IFN-gamma acts on the whole process of tumorigenesis and development, and its anti-tumor mechanism is mainly divided into immune mechanism and non-immune mechanism.IFN-gamma can directly inhibit tumor cell proliferation, promote tumor cell apoptosis, inhibit tumor angiogenesis, and cooperate with NK, NKT, γδT cells and CD4+/CD8+T cells of innate and adaptive immunity to complete tumor killing. In addition, IFN-gamma also has an important immunomodulatory function, which can improve the lysosomal activity of macrophages, and has an anti-proliferation effect on transformed cells.This product is the recombinant human Renin protein expressed from human 293 cells (HEK293).
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy