SKU: 90580954575

TNFRSF10B/TRAIL R2 Fc Chimera Protein, Mouse

Sale price$184.50 Regular price$205.00
Save 10%

Pay in installments of $51.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

TNFRSF10B/TRAIL R2 Fc Chimera Protein, MouseProduct Specification Species Mouse Antigen TNFRSF10B TRAIL R2 Synonyms TNFRSF10B,TRAILR2,TRAIL R2,CD262,DR5,KILLER,TRICK2,ZTNFR9 Accession Q9QZM4 Amino Acid Sequence Asn53 Ser177, with C terminal Mouse IgG Fc

Product Specification


Species Mouse
Antigen TNFRSF10B/TRAIL R2
Synonyms TNFRSF10B,TRAILR2,TRAIL-R2,CD262,DR5,KILLER,TRICK2,ZTNFR9
Accession Q9QZM4
Amino Acid Sequence

Asn53-Ser177, with C-terminal Mouse IgG Fc NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWASIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 45-60kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Walczak, H. et al. (1997) EMBO J. 16:5386.

Background

TNFRSF10B, also called TRAIL R2 and DR5, is a member of the TNF receptor superfamily.TRAIL-R2 contains two extracellular cysteine-rich repeats, typical for TNF receptor (TNFR) family members, and a cytoplasmic death domain. TNFRSF10B / DR-5 is widely expressed in adult and fetal tissues; very highly expressed in tumor cell lines. Human and mouse TRAIL R2 share 49% amino acid sequence similarity. Some studies have suggested that TNFRSF10B contributes more than TNFRSF10A (TRAIL R1) to TRAIL-induced apoptosis in cancer cells that express both receptors. In addition, agonistic monoclonal antibodies against TNFRSF10B, which can induce apoptosis in the absence of TRAIL, are used for cancer therapies.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 90580954575

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 14 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Dawn Tibbetts
Dallas, US
★★★★★ 5
Hard to Destroy
Style: Bunny
My puppy hasn’t been able to destroy it yet. All other toys have only lasted about 10 minutes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2026
A
Verified Purchase
Amazon Dot Comment
Natrona Heights, US
★★★★★ 1
Torn to shreds by a puppy.
Style: Bunny
Torn to shreds by a puppy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
I
Verified Purchase
Isidro mora
New York, US
★★★★★ 5
Very durable.
Style: Snake
My frenchie loves this snake very durable
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 13, 2026
J
jj
Bozeman, US
★★★★★ 4
A bit wider than I expected
Style: Coyote
I thought this was going to be a "flat" toy but was a bit surprised to see that it was more of a 3D shape than flat. It's unfortunately a bit too wide for my small/medium sized terrier so he really only grabs and chews on the tail and ears. It is pretty durable though and has held up well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 20, 2026
B
Brande B
Whiting, US
★★★★★ 5
Toughest dog toy we've ever owned! Jasper approved!
Style: Elk, Style: Elk
If you are the owner of a "power chewer" who usually turns standard plushies into a snowstorm of stuffing in under five minutes, the HOUND2O Elk Stuffed Animal is the heavy-duty solution you’ve been looking for. This isn't just a toy; it’s a rugged piece of outdoor-grade gear that manages to stay "plush" while being nearly indestructible. Here is why this elk is the gold standard for aggressive chewers. The "Ballistic" Build The secret to its toughness lies in the materials. Unlike cheap fleece or thin polyester, the HOUND2O Elk is engineered for extreme durability. Ballistic Nylon Shell: The body is wrapped in high-denier ballistic nylon—the same type of material used in tactical gear. It’s incredibly resistant to punctures and tears from sharp canine teeth. Reinforced TPR Accents: The "antlers" and specific high-wear points are reinforced with Thermoplastic Rubber (TPR). This gives your dog a satisfying, grippy texture to gnaw on without compromising the toy’s structural integrity. Extreme Stitching: The seams are double-stitched and recessed, making it nearly impossible for a dog to find a "weak spot" to start a rip. Built for Adventure: This toy is marketed for "outdoor adventures," and it truly lives up to that branding: Water-Resistant & Buoyant: Unlike most stuffed animals that become soggy, heavy sponges, this elk is water-resistant and it floats. It’s the perfect companion for a trip to the lake or a game of fetch in the pool. Easy to Clean: Because the material is so dense, mud and slobber don't soak in deeply. A quick rinse with a hose or a wipe-down with soap and water makes it look brand new after a day in the dirt. High Visibility: The vibrant colors and distinct shape make it easy to spot in tall grass or murky water, so you won't lose it during a long-range game of fetch. Engaging (But Tough) Squeaker For many aggressive chewers, the goal is to "silence" the squeaker as fast as possible. Protected Internal Squeaker: The squeaker is buried deep within the ballistic layers, making it much harder for a dog to pinpoint and puncture. It provides that high-value auditory feedback that keeps dogs engaged without being an easy "kill point" for the toy. Performance at a Glance Durability - Ballistic nylon and TPR are a "power chewer" dream. Versatility - Floats, easy to clean, and works indoors/outdoors. Engagement - Mixed textures (nylon + rubber) keep dogs interested. Value - Outlasts 10 standard plush toys combined. The HOUND2O Elk is a 10/10 for any pet parent tired of throwing away shredded toys. It is incredibly tough, intelligently designed, and built to withstand the "ruffest" play. While no toy is truly 100% indestructible for every single dog, this is as close as a plush-style toy can possibly get. If your dog loves the "thrill of the hunt," try hiding this elk in some tall grass or bushes outside. Its tough shell can handle the brush, and it’s a great way to provide mental stimulation alongside a heavy chewing session!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 13, 2026

recommand products