SKU: 87453694332

Human IL-6

Sale price$180.00 Regular price$200.00
Save 10%

Pay in installments of $50.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 23 - Aug 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-6Product Specification Species Human Synonyms Interleukin 6, B cell stimulatory factor 2 (BSF 2), CTL differentiation factor (CDF), Hybridoma growth factor, Interferon beta 2 (IFN beta 2), IL6, IFNB2 Accession P05231 Amino Acid Sequence Protein sequence (P05231, Val30 Met212)

Product Specification


Species Human
Synonyms Interleukin-6, B-cell stimulatory factor 2 (BSF-2), CTL differentiation factor (CDF), Hybridoma growth factor, Interferon beta-2 (IFN-beta-2), IL6, IFNB2
Accession P05231
Amino Acid Sequence

Protein sequence (P05231, Val30-Met212) VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Expression System HEK293
Molecular Weight

Predicted MW: 20.8 kDa Observed MW: 20, 21 kDa

Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Interleukin 6 (IL-6) is an interleukin that acts as both a pro-inflammatory cytokine and an anti-inflammatory myokine. Osteoblasts secrete IL-6 to stimulate osteoclast formation. Smooth muscle cells in the tunica media of many blood vessels also produce IL-6 as a pro-inflammatory cytokine. IL-6's role as an anti-inflammatory myokine is mediated through its inhibitory effects on TNF-alpha and IL-1 and its activation of IL-1ra and IL-10. There is some early evidence that IL-6 can be used as an inflammatory marker for severe COVID-19 infection with poor prognosis, in the context of the wider coronavirus pandemic. IL-6 stimulates the inflammatory and auto-immune processes in many diseases such as multiple sclerosis, neuromyelitis optica spectrum disorder (NMOSD), diabetes, atherosclerosis, depression, Alzheimer's disease, systemic lupus erythematosus, multiple myeloma, prostate cancer, Behçet's disease, rheumatoid arthritis, and intracerebral hemorrhage.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 87453694332

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 10 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jessica
Whiting, US
★★★★★ 5
You will not regret buying!!
Scent: Unscented, Size: 4 Ounce (Pack of 2)
I don't normally write product reviews but this soap truly deserves it. I had heard about beef tallow products as a carnivore dieter but hadn't paid too much attention to them until I found a huge mass on my thyroid. Suddenly, I'm looking at all the products that I use and am shocked that everything has endocrine disrupters like dyes and fragrances. This was the most natural soap I could find and what a huge turn around in my skin. I have always had certain areas that are habitually dry and even lotion would not 100% fix them. After using this soap for over 2 weeks, my skin is so smooth and almost has that glow you see in lotion commercials. I have not applied any lotion at all in the last 2 weeks and I'm softer than I have ever been. I even shaved with it and it was the smoothest shave I have ever had. I used to use conditioner to shave with and this soap is far superior. It is also far superior to the facial lotion soap I was using. My face isn't dry anymore and no more rebound oil. The people that I have told about this are immediately grossed out and think that the soap smells. There is an ever so slight hint of tallow but it does not last and once you start using the bar it isn't noticeable unless you sniff the bar itself. It does initially leave that sticky feeling that you get from Castille soap, which is strange when you're used to conventional beauty bars or body washes. But please don't quit using it! That sticky feeling is adding moisture and protection to your skin and once you towel off I promise you will not feel sticky. After a few weeks, I promise it won't feel weird anymore and you'll have the best skin of your life!! I'm sorry for the long review, but I am so grateful for this product. It is not only a beauty miracle but better for your whole body, no more toxic chemicals leaching through you skin. And people are not lying when they say this soap lasts. I use it twice a day and I still have a good sized bar left. Also, it really does not disintegrate like regular bar soaps. A few reviews mentioned it being expensive and my husband also commented on this when I bought it, but in my opinion it is extremely cost effective!! This is my rationale, it replaces the facial lotion wash, shaving conditioner, and the need for body lotion and it lasts a long time. My other reasoning is that the long term medical costs of using toxic products just doesn't seem worth it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 1, 2024
M
Verified Purchase
Maddie Turay
Massapequa, US
★★★★★ 5
Cleared up my skin!
Scent: Unscented, Size: 4 Ounce (Pack of 2)
I have been using this soap for a little over a year. I was on accutane to cure really stubborn acne and when I got off my acne came back. I started using this paired with a beef tallow and honey moisturizer as my only skincare and it cleared up my skin so well. I love this soap and it is so natural and nontoxic. Amazing product.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
R
Verified Purchase
Roel Y.
Alexandria, US
★★★★★ 5
Great Value for size
Scent: Unscented, Size: 4 Ounce (Pack of 2)
Great value for the size, has an almost milky scent which is quite nice, gentle on the skin, and clean ingredients. If you're looking for body soap without any chemicals, I highly recommend this product.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2026
C
Verified Purchase
cheyP
Houston, US
★★★★★ 4
Truth
Scent: Unscented, Size: 4 Ounce (Pack of 2)
I have used this product for just 4 days now. This will be good and bad. A good all natural soap is not going to sud up like other soaps, I was shocked when I read some of the reviews and suds or the lack of suds seemed to be a big issue. This soap has very little suds. Another issue was smell. I do not notice any smell at all, the next time I order this product I would like to try the lemon for a little sent. This bar will last a long time, a little really gos along way. I do not notice any dryness but my skins feels tighter which makes me think it’s dry. I use my favorite body lotion and all is good. After the first use my skin was noticeably brighter. I had a pimple on my chin that was forming. I left the soap on my face for about 1 min. The next morning the pimple was nearly gone day two completely gone. I use a face cream called Just Tallow and combined with this soap it’s a perfect match. Tonight I put some soap on my feet and scrubbed them with a pumice stone and my feet are so soft right now. This is a good product and I will order again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 4, 2024
J
Verified Purchase
Jesse
Charlottesville, US
★★★★★ 5
SMELLS AMAZING
The smell literally lasts all day and it smells so good. Seems to do very well as far as skin sensitivity.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 2, 2026

recommand products