SKU: 86665497834

AAK1 Protein

Sale price$345.15 Regular price$383.50
Save 10%

Pay in installments of $95.88 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

AAK1 ProteinProduct Specification Species Human Synonyms AAK1AP2 associated protein kinase 1 Accession Q2M2I8 1 Amino Acid Sequence T27 A365

Product Specification


Species Human
Synonyms AAK1,AP2-associated protein kinase 1
Accession Q2M2I8-1
Amino Acid Sequence

T27-A365

TSGLGSGYIGRVFGIGRQQVTVDEVLAEGGFAIVFLVRTSNGMKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVSSGDVWEVLILMDFCRGGQVVNLMNQRLQTGFTENEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKFQNPQTEGVNAVEDEIKKYTTLSYRAPEMVNLYSGKIITTKADIWALGCLLYKLCYFTLPFGESQVAICDGNFTIPDNSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLLKKECPIPNVQNSPIPAKLPEPVKASEAAAKKTQPKARLTDPIPTTETSIA

Expression System Baculovirus-InsectCells
Molecular Weight 40.2 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Liquid
Storage Buffer 20mM Tris, 300mM Nacl, 1mM DTT, pH8.0
Stability & Storage

-80℃

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 86665497834

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
P
Verified Purchase
Pompii
Alexandria, US
★★★★★ 5
The Air & Space Museum is a national treasure.
Format: Hardcover
This is one of those books that makes you wish you were there. Lots of pictures and tidbits of information. A good quality book physically as well. We get their magazine and this is one of many books we have both from and about the museum. Highly Recommended.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 12, 2018
W
Verified Purchase
Wavezz
West Palm Beach, US
★★★★★ 5
Great photo essay, history of aviation and space
i'm an engineer- worked rocket motors, and various satellite programs. this book was recommended by associate after visiting the museum at Langley. The pics are super, with short descriptions, and moderate on the tech. It's an amazing pulse of this wild history, and mostly is from America's lineage. St. Louis, Mercury, Atlas, and up to current Shuttle. There's also the SST, and unique turn of the century early birds. A fine read to be shared with a youngster (my son 10, digs it), or for the history or engineering buff. amazon has it cheaper than at the museum.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 18, 2007
C
Verified Purchase
Christopher Bell
Pawtucket, US
★★★★★ 5
Essential reading for PowerPoint presenters.
Format: Paperback, Format: Paperback
Cliff shows details how to improve our PowerPoint presentations. He gives concrete and simple steps to transform a message into a targeted presentation. All of us have suffered from presenters who went over their allotted time because they had vital information to give us, yet we still didn't know their main point. Many have seen slide decks burdened with dozens of bullet points. Did the volume of points yield more clarity or did they dull our ability to focus on the message? Probably not. Read Cliff's book. Follow his method and you'll be a more effective presenter.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 17, 2011
G
Verified Purchase
G.L.K.
Louisville, US
★★★★★ 4
Useful with some scientific corroboration
Format: Paperback
Worth it as a primer to slide content and how it inter-relates to the delivery when giving a presentation. Very slightly laboured, like most TV documentaries nowadays - you feel they could move a bit faster (...yeah we got it the first time).
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 9, 2012
T
Verified Purchase
Terry
Boise, US
★★★★★ 5
Simple and streamlined to meet anyone's needs
Format: Paperback
This book rocks! It provide a simple and structured way to define, develop and deliver a "Kick Ass" presentation that you can project or just use from the podium. It bring the audio and visual together to compliment a story to be shared. It has taken the hassel factor out of designing a presentation for anyone on any subject. Thank you!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 11, 2014

recommand products