SKU: 85753129676

Nucleocapsid CTD His Tag, SARS-CoV-2

Sale price$270.00 Regular price$300.00
Save 10%

Pay in installments of $75.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 23 - Aug 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Nucleocapsid CTD His Tag, SARS-CoV-2Product Specification Species SARS CoV 2 Synonyms SARS CoV 2 coronavirus NP Protein; SARS CoV 2 np Protein; SARS CoV 2 novel coronavirus Nucleoprotein Protein Accession P0DTC9 Amino Acid Sequence MHHHHHHHHTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFP. Expression System E. coli Molecular Weight 14. 5 kDa () Purity 95%, by SDS PAGE under reducing conditions Endotoxin <2EU g

Product Specification


Species SARS-CoV-2
Synonyms SARS-CoV-2 coronavirus NP Protein; SARS-CoV-2 np Protein; SARS-CoV-2 novel coronavirus Nucleoprotein Protein
Accession P0DTC9
Amino Acid Sequence MHHHHHHHHTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFP.
Expression System E.coli
Molecular Weight 14.5 kDa (还原状态)
Purity >95%, by SDS-PAGE under reducing conditions
Endotoxin <2EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM PB, 100mM NaCl, pH7.4
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

Nucleocapsid, nucleocapsid protein, is an important structural protein of novel coronavirus SARS-CoV-2, which is responsible for wrapping the virus RNA genome and then assembling virus particles. Nucleocapsid has two domains: NTD and CTD, in which CTD has two functions: binding to RNA genome and forming homodimer. There are many positively charged amino acid residues on the surface of CTD protein, which can bind to the negatively charged RNA genome by charge interaction. The two molecules of CTD can form a homodimer through the hydrophobic interaction between β-strands, and then form a higher-order polymer complex. Therefore, CTD plays an important role in the process of virus replication and assembly. In the process of novel coronavirus SARS-CoV-2 therapeutic drug development, CTD inhibitors have become a hot target for drug screening. At the same time, the antigen detection kit developed for CTD provides a more efficient and accurate detection method for SARS-CoV-2 detection.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 85753129676

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 5 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Alexandra C
Pawtucket, US
★★★★★ 5
These are handy and effective!
Color: Blossom
These work really well for cleaning phone/tablet screens, the display screen in my car, and any other screen surface. The material is soft and doesn’t scratch, doesn’t require any liquid cleaning product, and does a great job of removing smudges and dust. I like how portable they are-I can keep one in my car, one in my purse, one in my work bag, and one in my nightstand. I’ve reused them multiple times and they have stood up well to multiple uses with no apparent loss of cleaning ability.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 13, 2025
M
Verified Purchase
M.R.
Carnegie, US
★★★★★ 4
Work great, inexpensive, but…pic just a tad different
Color: Glitter Pink/Black
These work well, were worth the price, and made good stocking stuffers. I took off 1 star, because they appeared somewhat different from the photo. The photo made the glitter ones looked like they had stars as part of the pattern (like a night sky or outer space), but it seems like that effect was added to the photo to enhance the glittery appearance. They are, in fact, very sparkly and not very celestial, so they were just a tad more ‘girly’ than I was expecting. Nothing wrong with glitter and glam—just different from what I thought I was getting. On a positive note, the glitter is sealed in and doesn’t shed, so you won’t be spreading sparkly escapees for the rest of eternity. (I guess I would give 4.5 stars if I could)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 22, 2025
K
Verified Purchase
Kimberley Ronca
Houston, US
★★★★★ 5
Where have these been all my life?
Color: Glitter Pink/Black, Color: Glitter Pink/Black
I don’t understand why anyone would give this set of little miracles a bad review. I have wasted way too UHC money on too many products that never get my phone completely street and smudge free, especially around the edges where the phone and the case meet. That’s the area I’ve wasted the most time trying to get clean, to no avail. I have spent way too much time wiping the edges and corners over and over, but they never are completely streak-free. I saw these and figured I’d try them; it’d not like I wouldn’t be able to return them if they ended up being a just as useless as everything else I’ve tried, and even if I did forget to send them back, I wasn’t losing a ton of money. The first thing I did when they arrived I pulled one of them out, shoved two fingers under the elastic band, a major selling point for me because it keeps it secure without feeling claustrophobic., and started swirling all around the edges of my phone. And within seconds my phone screen looked brand new. The oily grime stuck in the corners and all along the edges was gone within seconds. Without any cleaning solution too, which I love that it’s an eco-friendly solution to keeping all that grossness off of my phone and tablet screens. I was in the middle of making cupcakes and had the bright idea of smearing a bit of butter on the screen of my tablet to see what happens. The results speak for themselves. And there’s no gross oily residue left on the pad I used to clean my tablet either when I was finished. I’m sure there’s an easy way to clean them…I’ll look into that when the need arises. The only issue I have is that I can’t buy them in an extra large size for cleaning tvs. The small ones will work perfectly, but an extra large one would get rid of every streak, smudge, fingerprint and lint within a few seconds. And you get it clean without any cleaning spray. You don’t even need water. Just open it up and use. I’d buy one to keep behind every tv in my house in a large size! They are the perfect size to keep in your purse or your pocket. I bought the glittery ones; my ADHD brain is immediately drawn to anything that sparkles. And getting four for the price is beyond a great deal. I highly recommend these little wonders if you are like me and hate seeing your grandchildren’s fingerprints smeared all over your tablets screen when they hand it back to you. Or if you reach the same level of frustration I’ve reached whenever I’ve tried to get every bit of oily grossness off of my phones screen. These are going to make great white elephant and last minute Christmas gifts and stocking stuffers. They arrived a day earlier than I expected too. Get these. You won’t regret it. Until you try them and you regret that you can’t get an extra large one for your televisions too!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 8, 2025
D
Verified Purchase
donna eb
Alexandria, US
★★★★★ 5
That it does what it says.
Love these they work do well on. My ipad, bought it 3 times as gifts for my friends.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026
A
Verified Purchase
Amazon Customer
Alexandria, US
★★★★★ 3
Hard to hold
Color: Shades of Blue
The straps is really tight, so it is hard to hold and maneuver. Colors are what I expected. The ability to clean screens is OK
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 4, 2025

recommand products