SKU: 85490424923

Human TIMP2 Protein, His Tag

Sale price$108.00 Regular price$120.00
Save 10%

Pay in installments of $30.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 24 - Aug 29

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human TIMP2 Protein, His TagProduct Specification Species Human Synonyms Metalloproteinase inhibitor 2, CSC 21K, Tissue inhibitor of metalloproteinases 2 (TIMP 2) Accession P16035 Amino Acid Sequence Protein sequence (P16035, Cys27 Pro220, with C His Tag) CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP Expression System HEK293

Product Specification


Species Human
Synonyms Metalloproteinase inhibitor 2, CSC-21K, Tissue inhibitor of metalloproteinases 2 (TIMP-2)
Accession P16035
Amino Acid Sequence

Protein sequence (P16035, Cys27-Pro220, with C-His Tag) CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Expression System HEK293
Molecular Weight Predicted MW: 23.4 kDa Observed MW: 20-25 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

TIMP2 (Tissue Inhibitor of Metalloproteinases 2) is a key regulatory protein belonging to the TIMP family, which inhibits matrix metalloproteinases (MMPs) to maintain extracellular matrix (ECM) homeostasis. By controlling MMP activity, TIMP2 plays a critical role in tissue remodeling, wound healing, and inflammation. Beyond its inhibitory function, TIMP2 exhibits MMP-independent activities, such as modulating cell growth, differentiation, and angiogenesis. It is also involved in pathological processes, including cancer progression and fibrosis, where its dysregulation contributes to ECM degradation or excessive deposition.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 85490424923

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Carla Tibbetts
Bozeman, US
★★★★★ 4
Not for chewers
Size: Medium Set of 6
Not for chewers, but I bet non chewers would like the. Good quality, bounce, fun color and texture. Fun while it lasted, but didn't last long with my 2 year old pitbull. We've been trying to find the replacement to his durable spiky ball that went down a sewage drain. Right now the Chuck-Its are the ones that last (minus just one)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 8, 2025
P
Verified Purchase
Pam Cunningham
Omaha, US
★★★★★ 5
Almost Indestructible!
Size: Medium Set of 6
My dog LOVES these balls, and it's all about the squeaker (which my husband hates). The size is great and I don't worry about it getting lodged in her throat. They are very durable too. We had one lone ball for YEARS and I forgot it ever squeaked, but it was still in tact. I searched for a replacement because I was so impressed with it. Very happy to have found it. I just ordered some for my son's dog too. The squeaker may eventually come loose, but it's worth the money to buy again!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 9, 2026
T
Verified Purchase
Terri C
Dallas, US
★★★★★ 5
Dog likes
Size: Medium Set of 6
My shepherd loves these.She loves a good squeak in a ball.Nice and lightweight.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
A
Verified Purchase
Amazon Customer
Charlottesville, US
★★★★★ 5
The most durable and fun dog toy of all
Size: Medium Set of 6
Most durable and fun toy of all. The only thing that I have found that can destroy these balls is a lawnmower. Probably good for keeping teeth clean too.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026
H
Verified Purchase
Hendrix
Pawtucket, US
★★★★★ 5
Dog approved
Size: 3.5" (Medium/Large Dog), Color: Set of 6
My 60lb 11mo puppy loves these balls! They do get a little softer the more she plays with them but they are light and squeezy enough for fun retrieve, catch, bounce and training. AND does not break things in the house since they are fairly squeezable. The sqeeky can be a little loud but it also helps get her attention and she is so excited to play with multiple ones. I'm also suspecting the plastic spikes may even help clean her teeth. They are the perfect size for a German shepherd. This multi-pack is great to have to use some outdoor, indoor, and i replace old ones after my pup gets them too dirty to wash.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 30, 2025

recommand products