SKU: 83220555241

Human EPO Protein, hFc Tag

Sale price$94.50 Regular price$105.00
Save 10%

Pay in installments of $26.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 20 - Sep 25

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human EPO Protein, hFc TagProduct Specification Species Human Synonyms Erythropoietin Accession P01588 Amino Acid Sequence Protein sequence (P01588, Ala28 Arg193, with N hFc tag) APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR Expression System HEK293 Molecular Weight Predicted MW: 45. 3 kDa Observed MW: 60 70 kDa Purity 95% by SDS PAGE Endotoxin <1EU g

Product Specification


Species Human
Synonyms Erythropoietin
Accession P01588
Amino Acid Sequence

Protein sequence (P01588, Ala28-Arg193, with N-hFc tag) APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

Expression System HEK293
Molecular Weight Predicted MW: 45.3 kDa Observed MW: 60-70 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with N-hFc tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Erythropoietin (EPO) is a glycoprotein hormone primarily produced by the kidneys in response to hypoxia. It stimulates red blood cell production (erythropoiesis) in the bone marrow by binding to the EPO receptor on progenitor cells. Clinically, recombinant human EPO (rhEPO) treats anemia associated with chronic kidney disease and chemotherapy. Beyond hematopoiesis, EPO exhibits tissue-protective effects in the brain and heart.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 83220555241

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 22 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Danielle Terkhanian
Charlottesville, US
★★★★★ 5
A ghost story with tons of heart
Format: Hardcover
On the surface, this is a story about two kids ghost hunting in the Appalachian woods. But in reality, it's a beautifully nuanced exploration of loving (but messy) families, opening up to those you love, kindling new friendships, cherishing and protecting the environment, facing challenging emotions head on, and so much more. I'm so grateful that highly sensitive children (and adults) will get to know this empathetic, peace-keeping main character. There are so many protagonists that save the day with their heroics, but bravery so much more often looks like Tennie. This book serves as a beautiful reminder for those of us constantly filling others' buckets that our own needs and wants matter too.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 15, 2023
B
Verified Purchase
Beth Gawlik
Boise, US
★★★★★ 5
Delightful spooky middle grade
Format: Hardcover
I was thrilled to learn that Ash Van Otterloo was releasing a second spooky middle grade set in Howler's Hollow. Instead of the zombies we find in Cattywampus, this book stars a girl who can release memories and, it turns out, ghosts from objects. She needs to figure out what the ghosts are trying to tell her before it's too late.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 21, 2022
J
Jim Sibigtroth
Whiting, US
★★★★★ 4
Good middle-grade fantasy/mystery
Format: Kindle
The they/them pronouns made for difficult reading at times but the strength of the family a friendship dynamics more than made up for that. An adult reader may see some of the ‘surprises’ coming but typical middle grade readers probably wouldn’t be able to read between the lines well enough to spoil the surprise twists.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 27, 2022
K
Verified Purchase
Kindle Customer
Lake Worth, US
★★★★★ 5
A book with so much heart
Format: Kindle
An absolutely delightful story with the perfect amount of spookiness. Light-hearted but also deep in its exploration of the ways we push down our own souls because of what we think others need.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 18, 2022
E
Evren D
Phoenix, US
★★★★★ 5
Spooky Middle Grade Book
Format: Hardcover
I cannot explain how excited I was to hear that Ash Van Otterloo was putting out another book. I was a big fan of Cattywampus and was very excited once I read the summary of this book. I requested and was granted an ARC copy of this book by Scholastic in exchange for a fair and honest review. I don’t think I have the exact words to express how much I adore this book. I’ve only recently discovered that as an adult I can actually enjoy middle grade books and this book has probably become one of my new all-time favorite books ever. One of the biggest things that I adored about this book is the characters. Tennie is an absolute sweetheart who is way to willing to give up and hide pieces of herself for the sake of keeping the peace. It’s sweet and heartbreaking at the same time. I also love towards the end when she gets some fire in her. Fox was also quite a character. They’re kind of a bit much at times, but they’re also aware of their faults. They know that they can forget things and that they might annoy their friends, but they also try to soothe things over. I honestly really liked them, and it was really nice to see a character using they/them pronouns so casually. The two characters had a really nice dynamic with each other. They grew close quickly, the way kids do, and delved into a ghost hunting adventure. It was honestly really cute and heartwarming to watch them grow closer. This also felt really good because of Tennie and her desire to always be the peacekeeper. She even considered being friends with Fox and exploring the forest together as her being “selfish”. I just really loved it and their interactions made me so happy. It wasn’t always great, but it just gave me so much joy and I was constantly smiling. I did not expect to love the atmosphere that was created in this book. It was sufficiently spooky without being necessarily scary. It worked really well in the town of Howler’s Hollow. Howler’s Hollow is a town in the rural south, somewhere that’s not always popular with the LGBTQ+ community. The thing is, I don’t know if this book would have worked as well in other locations. It’s one of those towns where everyone seems to know everyone. It appears to be relatively close-knit, even if the people don’t always get on, and it has a great forest. The forest allows the atmosphere to be appropriately creepy while the people in the town add a source of information for Tennie and Fox. It was also built up very well and created an atmosphere that led to a great payoff at the end. I cannot fully encapsulate everything that I love about this book, but I will recommend it to everyone who asks. This book is fun and whimsical with a dark edge and serious topics that need to be explored. It might hurt at times when things are discussed, but it has a happy ending.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 7, 2021

recommand products