Pay in installments of $80.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 25 - Aug 30
For Your Every Summer RSVP, with Code: SUMMER15
Description
FABP7 His Tag Protein, HumanProduct Specification Species Human Synonyms Fatty acid binding protein 7 Accession O15540 Amino Acid Sequence Val2 Ala132, with N terminal 8*His MHHHHHHHHVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA Expression System E. coli Molecular Weight 16kDa (Reducing) Purity 95% by SDS PAGE & RP HPLC Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance
Product Specification
| Species | Human |
| Synonyms | Fatty acid binding protein 7 |
| Accession | O15540 |
| Amino Acid Sequence | Val2-Ala132, with N-terminal 8*His MHHHHHHHHVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA |
| Expression System | E.coli |
| Molecular Weight | 16kDa (Reducing) |
| Purity | >95% by SDS-PAGE & RP-HPLC |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 20mM Tris, 100mM NaCl, pH8.0 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
Fatty acid binding protein 7 (FABP7, alternative names brain FABP (B-FABP), brain lipid-binding protein (BLBP) and mammary derived growth inhibitor-related gene (MRG)). Compared to normal brain tissue and low-grade astrocytomas, FABP7 is up-regulated in glioblastoma, and increased nuclear localization of FABP7 in glioblastoma is associated with EGFR amplification and poorer outcomes. The expression of FABP7 is also linked to enhanced cell motility and migration, with a decreasing docosahexaenoic acid (DHA, [ω-3])-arachidonic acid (AA, [ω-6]) ratio appearing to govern these effects, perturbing the normal, tightly regulated ratio of fatty acids in brain tissue and providing increased substrate for prostaglandins such as PGE2 to promote progression.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.8 ★★★★★
Based on 14 reviews
Sort
Product Reviews
★★★★★ 5
Cheap Insurance - Easy Claims Process!
I bought this warranty plan for a Dell monitor about 3.5 years ago. About a month ago, it started to give me some intermittent problems (very fast flickering & image retention). I tried everything I could to troubleshoot the issue, but it just kept coming back.
I had some issues with logging into my Asurion account because I used an EDU email, which I no longer have access to. I sent a message to Asurion here on Amazon and they sent me my plan details and everything I needed to make a claim within 24 hrs.
Once I was able to log into my account online, the claims process couldn't be faster/easier. I used the chat function and provided the rep with the issues I was having with my monitor. The rep immediately emailed me a pre-paid UPS label to send my monitor to one of their repair facilities. I got another email when my monitor was received stating that repairs could take up to 5 business days. However, the very next day I got another email stating that my monitor couldn't be repaired and they would be reimbursing me the full purchase price. I received another email with an Amazon gift card for the full price of the monitor within minutes.
This is my first experience with Asurion and I'm very impressed. The customer service is top notch. If I ever buy another expensive electronic item from Amazon, I'm definitely buying an extended warranty from Asurion.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 19, 2025
★★★★★ 5
Better pricing than BestBuy’s Geek Squad extended warranty!
Asurion is on of the best extended warranty put there! bar none! I used to buy only from BestBuy because of their Geek Squad extended warranty. But it’s way more expensive compared to Asurion. although with Asurion they require so much paper work and pictures first.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 26, 2025
★★★★★ 4
They refunded the amount. We just had to send it to them 2 times before they did.
We bought a printer and it was having issues from the beginning. We thought at first it had to do with the WIFI, so we didn't say anything, but then more things were going wrong. I talked to the manufacturer, who said it needed to be replaced but we had to go through Asurion. Asurion "fixed" it and sent it back but we had our doubts. Sure enough, it was within the same month we were sending it in again.
This time they just gave us an amazon gift card for the entire amount we had paid. Thankful for the warranty. They ultimately did the right thing, I just wish we could have gotten it done faster.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 9, 2023
★★★★★ 5
Get protected!
Very easy to use and responsive.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 6, 2026
★★★★★ 5
Very helpful
Good plan to have.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 21, 2026