SKU: 73681158896

Mouse IgG kappa, His tag

Sale price$117.00 Regular price$130.00
Save 10%

Pay in installments of $32.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 25 - Aug 30

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse IgG kappa, His tagProduct Specification Species Mouse Synonyms Ig kappa chain C region MOPC 21 Accession P01837 Amino Acid Sequence Protein sequence (P01837, Arg1 Cys107, with C 10*His) RADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNECGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 13. 6 kDa Observed MW: 13. 6 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag with C 10*His Physical

Product Specification


Species Mouse
Synonyms Ig kappa chain C region MOPC 21
Accession P01837
Amino Acid Sequence

Protein sequence (P01837, Arg1-Cys107, with C-10*His) RADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNECGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 13.6 kDa Observed MW: 13.6 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Immunoglobulin kappa constant, also known as IGKC, is a gene that encodes the constant domain of kappa-type light chains for antibodies. The immunoglobulin light chain is the small polypeptide subunit of an antibody (immunoglobulin). A typical antibody is composed of two immunoglobulin (Ig) heavy chains and two Ig light chains. kappa (κ) chain is one of the two types of light chain in humans. A free light chains test measures the amount of lambda and kappa free light chains in the blood. If the amount of free light chains is higher or lower than normal, it can mean you have a disorder of the plasma cells. These include multiple myeloma, a cancer of plasma cells, and amyloidosis, a condition that causes a dangerous buildup of proteins in different organs and tissues.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 73681158896

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kindle Customer
Boise, US
★★★★★ 5
Excellent Parallel Worlds and Xianxia Story
Format: Kindle
The story follows two affable characters, Rugrat and Eric. Rugrat is a wonderfully written redneck and Erik plays the role of an exasperated and loyal brother in arms. The two main characters interactions between each other bring interesting banter to the different parts of the story that other wise progress too slowly. It’s a cultivation novel and the main characters often take a great deal of time learning more about the system and how they can leverage its powers. The magic system in world combines well with the parallel world aspect, and the main characters thrive in their new environment. The stats, like in many other stories in this genre, serve as relatively arbitrary plot pieces that could be easily handled without the stats. The potential for growth and the magic systems interesting interactions with modern technology makes the magic satisfying to read about. My favorite aspect of the story so far is the clashing of the honorable soldier mentality with the “might makes right” philosophy of martial arts cultivation novels. Though it’s clear the author heavily favors one philosophy over the other. A great read, and an excellent novel to enjoy as an audiobook.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 7, 2019
J
Verified Purchase
Joe D
Natrona Heights, US
★★★★★ 4
Xianxia-inspired novel I can actually read
Format: Kindle
I've read (or attempted to read) several wuxia/xianxia stories in the past. This is probably the best of that genre that I've tried. I know, such a titillating opening statement, but hear me out: this story is very good. NOT great, but not the typical "my eyes wish to bleed from my skull" experience, either. Most Chinese fantasy is bad. I wish that were not so, hence me trying to find good stories. In general, the stories don't make a lot of sense, and the grammar and repetitive phrasing makes the translations a generally terrible experience. Coming from a background of looking at college student papers, I've had my fill of bad grammar and poor sentence structure; I don't need more. With an English speaking author at the helm, however, this was a pleasant ride. There were a few grammatical errors but nothing to get my pants in a twist over. The story mostly makes sense, with only the two main characters occasionally speaking like locals throwing me off a bit, as well as the two of them growing so used to elements of their surroundings and quest rewards. It just felt a little unnatural in places. My biggest gripe is how they suddenly sprout knowledge of city planning and infrastructure. That really felt out of character, and came out of left field. Other than that, I think this was a solid first entry for this series.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 1, 2019
J
Verified Purchase
jermel purse
Lowell, US
★★★★★ 5
Great great great but …..
Format: Kindle
Before I get into the meat and potatoes of this review this is a five star book. I have to say that starting out it is a five star book now rarely is a book absolutely perfect don’t get me wrong there are some classics in this genre or others that are just perfect now since this is the first book in the series it’s not perfect there are some points where concepts could’ve been made clear there are some points where things run a little long arcs in the story run a little long but overall it’s a 10. Imagine you going to a five star immaculate restaurant you sit down to eat and the waiter brings you your food they make one mistake they spill a drop of wine on the tablecloth is that a big deal no does it diminish the experience no but you notice it. Same thing here. No onto some specifics 10 realms has a great progression system two dynamic MC’s and a sort of bro shooter story. That’s what you get here and you get lots of that here. When you finish the book you’re going to want to move onto the next so you know it’s a great book now there are times when the story slows down it goes a little too slow in the middle of the book again you could flip through and to be past it but ultimately you can read through it and you will be better for it. Is it that bad no not really but you do notice it. Once the story really picks back up your back into it and like I said you’re going to want to continue it. Since it is the first book in the series I can understand this problem I’d like many others look forward to seeing what is next.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2022
J
Verified Purchase
Jennifer C.
Birmingham, US
★★★★★ 5
Interesting twist on an Isekai
Format: Kindle
I really enjoyed this novel. Not only are the two main characters well developed, but so are the side characters. The slice-of-life setup is done well, with with you (the reader) being pulled along into the story. Right from the beginning, the author is successful in getting you to be fully invested in their struggles. While the book could stand to have another editorial pass, it does not detract greatly from the story. I also really enjoyed the Beast Mountain Trials. Far from your standard dungeon run, the - contestants? participants? contender? - whatever you want to call the people who participate in the Trials alongside Erik and Rugrat, who sort of fall into the Trials while trying to just live their lives and figure out how the Ten Realms things works, all participate in the different levels to see how far they can go. While the sect elders seem to understand that passing all the levels grants that person control of the dungeon, it also seems like everybody else who participates (or has participated) stops short of the last trial. Well, either that or, while they may successfully withstand the waves of beasts - the letter of the quest - they fail in the spirit of the quest, and thus fail to "beat" the dungeon. Given the way the villagers respond to Erik and Rugrat almost every time they do something to improve the villagers - often at their own expense or sacrifice - it is clear that the Ten Realms is very much a Darwin-esque universe. The strong rise to the top; the weak fall to the bottom. Yet, the many citizens of the universe, at least in the First Realm, have clearly failed to realize that they are stronger together. Which is perhaps why no one else has successfully completed the Beast Mountain Trials. Finally, while I knew that Erik and Rugrat were going to enact their revenge upon the Moon Healing House, I did not expect ... that. Not to say that it wasn't warranted, not out of character. Nor was is really unexpected. Not really. I was just a little surprised at the sheer coldness of it. I am definitely looking forward to reading the next book, as Erik and Rugrat ascend to Second Realm to continue their work toward healing the dungeon.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 27, 2021
C
Verified Purchase
Ciprian Dumea
Whiting, US
★★★★★ 5
Another great start to an interesting series :)
Format: Kindle
A great start to a new series, a very good hybrid between a light LitRPG and Wuxia combination which somehow is greater than the sum of its parts. For LitRPG aficionados, the leveling system is pretty basic, but solid, the crafting part bringing it a lot more flesh and sparkle. For those who like Wuxia, they will instantly recognize many of the concepts and may enjoy (as I know I did) the emergent clash between the `strength first` philosophy so prevalent in Wuxia novels and the `strength with a helping hand` model of many Western writings. The second part of the novel contains some town-building, tower-defense elements which I found well-thought out and interesting, and I am truly looking forward to the way they will develop `in the next realms`. The protagonists are interesting, you can really empathize with them, especially at first, and the character building is slow but steady. I was surprised by the specializations they chose, and I absolutely loved the healer/healing part of the world-building, for me it was fascinating. I think I read the book in one day, even it is by no means short, and I found it very enjoyable.I am looking forward to all its sequels!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 24, 2018

recommand products