SKU: 71128672547

Human Lambda, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Lambda, His tagProduct Specification Species Human Accession P0CG04 Amino Acid Sequence Protein sequence(P0CG04, Gly1 Ser106, with C 10*His) GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECSGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 13kDa Actual: 17kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer

Product Specification


Species Human
Accession P0CG04
Amino Acid Sequence

Protein sequence(P0CG04, Gly1-Ser106, with C-10*His)
GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECSGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 13kDa Actual: 17kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

The immunoglobulin light chain is the small polypeptide subunit of an antibody (immunoglobulin). There are two types of light chain in humans: kappa (κ) chain and lambda (λ) chain. Individual B-cells in lymphoid tissue possess either kappa or lambda light chains, but never both together. Specific rearrangement of lambda light chain of immunoglobulins can lead to loss of some protein coding genes. Using immunohistochemistry, it is possible to determine the relative abundance of B-cells expressing kappa and lambda light chains. If the lymph node or similar tissue is reactive, or otherwise benign, it should possess a mixture of kappa positive and lambda positive cells. If, however, one type of light chain is significantly more common than the other, the cells are likely all derived from a small clonal population, which may indicate a malignant condition, such as B-cell lymphoma.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 71128672547

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Scgirlie
Carnegie, US
★★★★★ 5
Surprisingly good!
Format: Kindle
I wasn’t sure I could forgive them and that’s always my issue with betrayal books - can I forgive the mmc, plural in this case, but the author was absolutely able to get me to that point. Yea I struggled with one them especially but overall I loved the book!! Followed the author immediately
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 29, 2025
M
mandie
Phoenix, US
★★★★★ 4
Amazing read!!
Format: Kindle
Where to begin. I loved this book. The characters had a way of pulling you in and making you holding your breath at the same time. I absolutely loved the fmc. Eva has a way of being vulnerable but strong. She is unwilling to give up. The mmc’s are truly horrible at the beginning. With that being said, I still found myself rooting for them. Over time you could them changing and how even when they wanted to hate her they just couldn’t find it in them. A truly remarkable love came from a terrible beginning. Loved it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 12, 2025
S
S.O.
Port Orchard, US
★★★★★ 3
Not bad but read better omegaverse
Format: Kindle
Mmm. I have feelings. Some not good. Some good. It was an ok read. I've been on a omegaverse kick for awhile now. Love me some groveling alphas but this wasn't it. Actually there wasn't enough groveling and the fmc gave in WAY too quickly. They all have f'ed childhood. The alphas, Dorian, Rafe and Cade met at an orphanage that did unspeakable things to them until Dorian and Rafe aged out at 18 and had ti wait a few years until they could "adopt" Cade, who was 3 years younger than them. They all become successful entrepreneur of sort, I think. They created an app called HeatLink. The fmc, Eva, was sold to the pack by her horrible, abusing father. She endured just as much hardship. She is relentless with escaping the pack but she always gave in when they got too near. Like she couldn't keep her legs closed. She hates them but gave in everytime. I found her kind of weak in that sense. The overall plot was fine. Didn't leave me yearning to read the next page. I did clock one of the identity of someone quickly though. Don't want to spoil it. Again, I've read better omegaverse books. The one good thing about the book is one of the lines from Cade on page 218: ""Please Eva. I'm sorry." She staggered back and I followed her on my knees, dragging myself. I didn't care. I just wanted her to hold me."" I'll admit, I melted a little bit for Cade, even though he was probably the worse a-hole out of the bunch.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 9, 2026
L
LaChante Anderson
San Leandro, US
★★★★★ 5
Good Groveling!
Format: Kindle
⭐️⭐️⭐️⭐️.5|🌶️🌶️🌶️🌶️.5 This was really good! Definitely a dark romance! The plot was really good and was done well. I enjoyed the character development but I did wish the FMC told her pack she loved them at the end. Overall I would recommend this to readers who like bully romances and groveling! 💖
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 24, 2026
A
Verified Purchase
Alice Wonder
Louisville, US
★★★★★ 2
it went on too long…
Format: Kindle
At first it was a good read and I was really into it then it got to be a little to much with every page being more about how “slick” she was or about constant sex… I like spice don’t get me wrong but this was just a little too much after a while and the plot was lost. I also felt like the ending was weird and awkward it was just a good build up to fall flat
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026

recommand products