SKU: 71001377253

HBV Surface Antigen-preS2

Sale price$72.00 Regular price$80.00
Save 10%

Pay in installments of $20.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 25 - Aug 30

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

HBV Surface Antigen-preS2Product Specification Species HBV Synonyms Middle surface antigen; PreS2 Amino Acid Sequence MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPN Expression System E. coli Molecular Weight 5. 8 kDa(Reducing) Purity 95%, by SDS PAGE under reducing conditions Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer 20mM PB, 50mM NaCl, pH7. 4 Reconstitution Reconstitute at less than 1 mg mL according

Product Specification


Species HBV
Synonyms Middle surface antigen; PreS2
Amino Acid Sequence

MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPN

Expression System E.coli
Molecular Weight 5.8 kDa(Reducing)
Purity

>95%, by SDS-PAGE under reducing conditions

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM PB, 50mM NaCl, pH7.4
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

Hepatitis B surface antigen S2 (HBV Surface Antigen-preS2) is the smallest unit of transcriptional activator encoded by the surface gene of hepatitis B virus (HBV). It can be used as an auxiliary diagnostic reagent for hepatitis B virus infection. It exists in more than 1/3 of HBV integration units, and HBV integration units are an important factor in inducing liver cancer (HCC). HBV Surface Antigen-preS2 is also an effective regulator of apoptosis induced by tumor necrosis factor-related apoptosis-inducing ligand (TRAIL). It is involved in promoting hepatocyte apoptosis induced by TRAIL, thereby increasing the risk of malignant transformation of human hepatocellular carcinoma cell line (HepG2).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 71001377253

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Miss Washington Creates
Boise, US
★★★★★ 5
My go-to sublimation paper for crafting
Size: 8.5"x11"
I've used several sublimation papers, and this one has worked really well for my crafting projects. The colors transfer bright and vibrant, and the images come out crisp with good detail when using the proper sublimation printer and ink. The paper feeds smoothly through my printer and feels like a good quality weight—not too thin and not overly thick. I've used it for tumblers, keychains, and other sublimation projects, and I've been happy with the results. I also appreciate getting 110 sheets in one pack because it lasts a while, especially when working on multiple projects at once. Overall, this is a reliable sublimation paper that gives consistent results and is great for crafters or small business owners.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
B
Verified Purchase
B.Nicole
Belleville, US
★★★★★ 5
My Go-To Sublimation Paper — Flawless Results Every Time
Size: 8.5"x11", Size: 8.5"x11"
This is hands down the best sublimation paper I’ve used and the only one I continue to buy. I get a perfect transfer every single time—no fracturing, no fading, and no uneven results. The paper dries fast, which makes my workflow so much smoother, especially when I’m producing items in batches. I use this regularly to make air fresheners and tote bags for my small business, and the color payoff is always vibrant and crisp. The transfer rate is excellent, and it works beautifully on light-colored, high-quality polyester and other sublimation-ready surfaces. If you’re a small business owner or crafter who values consistency, quality, and ease of use, this paper is absolutely worth it. I highly recommend it and will continue to repurchase.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 24, 2026
J
Verified Purchase
Jimmy
San Leandro, US
★★★★★ 5
Best Sublimation Paper
Size: 8.5"x11"
I’ve been using A-Sub paper for my sublimation projects, and it is easily one of the best. The ink dries almost instantly once printed, so I don’t have to worry about smudging the design or getting those annoying "pizza wheel" marks from the printer rollers. The paper itself feels substantial and doesn't tear or curl easily. One of the biggest wins for me is that it never jams; it feeds through perfectly every time, saving me the frustration of wasting expensive ink and paper. When I go to press my designs, the ink releases almost completely, leaving very little behind on the paper and putting all that color onto the project. The final results look super professional, with colors that are vibrant and sharp rather than looking faded or dull. It has worked perfectly for everything I’ve tried so far, and if you want a reliable paper that gives you consistent, high-quality results, this is definitely the one to get.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 25, 2026
N
Verified Purchase
Nadiagne
Carnegie, US
★★★★★ 5
Ideal for sublimation beginners.
Size: 8.5"x11"
Asub sublimation paper has been excellent for my projects. The ink transfer is very good, the colors are vibrant and defined, and it dries quickly. It has helped me achieve clean and professional results, even as a beginner. Without a doubt, it's a reliable, high-quality paper for sublimation.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 15, 2026
C
Verified Purchase
Chiller Leonard
Houston, US
★★★★★ 5
Excellent works great and I’m bang for your buck
Size: 8.5"x14"
I love this paper. It prints, nice and clear I will be buying more.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026

recommand products