Pay in installments of $52.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 24 - Aug 29
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human ANGPT2 Protein, His tagProduct Specification Species Human Synonyms Angiopoietin 2, ANG 2 Accession O15123 Amino Acid Sequence Protein sequence (O15123, Asp68 Phe496, with C His tag)
Product Specification
| Species | Human |
| Synonyms | Angiopoietin-2, ANG-2 |
| Accession | O15123 |
| Amino Acid Sequence | Protein sequence (O15123, Asp68-Phe496, with C-His tag) DAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF |
| Expression System | HEK293 |
| Molecular Weight | Predicted MW: 51 kDa Observed MW: 72 kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | with C-His tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. |
Background
Angiopoietin - 2 (ANGPT2) is a significant protein in the angiopoietin family. It plays a crucial role in angiogenesis, the process of new blood vessel formation. ANGPT2 is produced by endothelial cells and acts as a key regulator in vascular remodeling. Functionally, ANGPT2 binds to the Tie2 receptor on endothelial cells. In the presence of vascular endothelial growth factor (VEGF), ANGPT2 promotes endothelial cell destabilization, leading to increased vascular permeability and facilitating angiogenesis. However, in the absence of VEGF, it can cause vessel regression. Abnormal levels of ANGPT2 have been linked to various pathological conditions. In cancer, elevated ANGPT2 often correlates with tumor angiogenesis and metastasis, as tumors rely on new blood vessels for growth and spread. Additionally, it is involved in inflammatory diseases and eye disorders related to abnormal blood vessel growth, making it an important target for research into novel therapies.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy