SKU: 68946239678

CD27 Ligand/TNFSF7 Fc Chimera Protein, Human

Sale price$250.56 Regular price$278.40
Save 10%

Pay in installments of $69.60 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD27 Ligand/TNFSF7 Fc Chimera Protein, HumanProduct Specification Species Human Synonyms CD27 ligand, CD27L, CD27LG, TNFSF7, CD70 Accession P32970 Amino Acid Sequence Gln39 Pro193, with N terminal Human IgG1 Fc

Product Specification


Species Human
Synonyms CD27 ligand, CD27L, CD27LG, TNFSF7, CD70
Accession P32970
Amino Acid Sequence

Gln39-Pro193, with N-terminal Human IgG1 Fc PKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKIEGRQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP

Expression System HEK293
Molecular Weight

45-50kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1. Goodwin RG, Alderson MR, Smith CA, et al. Molecular and biological characterization of a ligand for CD27 defines a new family of cytokines with homology to tumor necrosis factor. Cell. 1993;73:447-456.

Background

The TNFSF7 gene (Tumor Necrosis Factor Ligand Superfamily, member 7) localized on C19p13 is a surface antigen found on activated, but not resting, T and B lymphocytes. It is a 19 amino acid protein containing a 20-amino acid hydrophilic N-terminal domain that lacks a signal sequence; an 18-amino acid hydrophobic region that presumably functions as a transmembrane anchor; and a C-terminal domain that contains 2 potential N-linked glycosylation sites is extracellular classifying TNFSF7 as a type II transmembrane protein. TNFSF7 expressed on a subset of B, T and NK cells, where it plays a costimulatory role in immune cell activation. TNFSF7 is homologous to the ligands of the TNF receptor family, including TNF-alpha, TNF-beta and the CD40 ligand, showing 19 to 24% amino acid sequence identity in the extracellular region. TNFSF7 gene expression is epigenetically down-regulated via DNA hypermethylation within its promoter region during progression in breast cancer cells in the isogenic MCF10 model.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 68946239678

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 20 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
P
Verified Purchase
P. Fuller
Charlottesville, US
★★★★★ 5
Versatile and Sturdy Storage Solution
Size: 2.5" & 4" - 4 Pack, Style: Open Hooks, Size: 2.5" & 4" - 4 Pack, Style: Open Hooks
The GATOR MAGNETICS Open Storage Hook has been a great (pricey) solution for adding hooks that are strong and useful. Its simple yet robust design makes it incredibly versatile for various uses around the house. The hook feels sturdy and durable, capable of holding a surprising amount of weight without bending or warping. Installation is as easy as blinking your eyes; the really strong magnets allow for easy attachment to any magnetic surface, and the hook remains securely in place. I've used it for hanging lights and bags in my office and bedroom, providing a neat and accessible storage solution in any setting. The open design ensures quick access to items without the hassle of removing them from a closed loop, which is a fantastic convenience. The magnet seems to be protected well enough with a rubber surface so that I don't have to worry about damaging my tables that I have attached these hooks. In terms of value for money, this storage hook is pricey but no competition that I've seen with the same level of durability and convenience. I'm impressed by its performance and versatility, making it a must-have for anyone looking to organize their space efficiently. Pros: Sturdy and durable build quality Easy magnetic installation on metal surfaces Versatile usage for multiple items Convenient open design for quick access Doesn't damage surfaces Cons: None that I've encountered so far! (Maybe price?) Overall, I highly recommend the GATOR MAGNETICS Open Storage Hook for its durability, versatility, and exceptional functionality. It's a small investment that brings significant organization and efficiency to any space.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 21, 2023
R
Verified Purchase
Roy Cox
Omaha, US
★★★★★ 5
Amazingly strong and versatile
Size: 2.5" & 4" - 4 Pack, Style: Open Hooks
I saw these advertised on Instagram and immediately purchased a 4 pack. I really wanted them to work but after trying them on 4-5 different steel surfaces I couldn't'[t get any of them to stick well or hold anything heavier than a wet towel. Maybe a bad batch? A shame. The company took the time to reach out to me after seeing my first review where the hooks wound stick to metal poles in my studio. I definitely was not expecting them to reach out to address my issues with the hooks I purchased and returned. After trying the new replacement hooks out I now could not be more impressed! They are strong, well made and easy to use. The hooks and the magnetic baskets are phenomenal and I highly recommend them. I did a test with the hooks, which held a 75 lb weight with no issues on the side of a craftsman tool box! It seems that any early product issues are fixed. The customer service is fantastic and they really took the time to address the issues and keep their customers coming back happy. Well done! Gator Magnetics is definitely a class act in my book!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 15, 2024
D
Verified Purchase
darren
Lowell, US
★★★★★ 5
Easy to use!
These work great for a metal workshop! Holds up my 6ft ladder and pressure washer hose with ease. Definitely recommend
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 20, 2026
M
Verified Purchase
Mark Archer
Alexandria, US
★★★★★ 4
25 lb hanger doesn’t hold my Echo trimmer
Size: 4" - Red, Style: Open Hooks, Size: 4" - Red, Style: Open Hooks
Purchased the holders for my Echo trimmer and hedger but the tines are not long enough to hold the Echos. A picture in the description shows a gas powered unit hanging which is why I bought the hangers. Buy the larger 45 lb hanger for trimmers. Nice hook but I’ll probably send them back if i can’t find a use for them soon.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 30, 2025
A
Verified Purchase
Amazon Customer
Carnegie, US
★★★★★ 5
Handy
Size: 4" - Black, Style: Open Hooks
I use an ocean container for storage and have some things that need to be hanging. These are perfect for any place you are unable to drive nails. I bought the stronger ones and have had no problems. Ordered more after trying them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026

recommand products