SKU: 68803853175

Human CD326/EPCAM, His tag

Sale price$108.00 Regular price$120.00
Save 10%

Pay in installments of $30.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 10 - Sep 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD326/EPCAM, His tagProduct Specification Species Human Synonyms Adenocarcinoma associated antigen, Cell surface glycoprotein Trop 1, Epithelial cell surface antigen, Epithelial glycoprotein (EGP), Epithelial glycoprotein 314 (EGP314; hEGP314), KS 1 4 antigen, KSA, Major gastrointestinal tumor associated protein GA733 2, Tumor associated calcium signal transducer 1, GA733 2, M1S2, M4S1, MIC18, TACSTD1, TROP1 Accession P16422 Amino Acid Sequence Protein sequence (P16422,

Product Specification


Species Human
Synonyms Adenocarcinoma-associated antigen, Cell surface glycoprotein Trop-1, Epithelial cell surface antigen, Epithelial glycoprotein (EGP), Epithelial glycoprotein 314 (EGP314; hEGP314), KS 1/4 antigen, KSA, Major gastrointestinal tumor-associated protein GA733-2, Tumor-associated calcium signal transducer 1, GA733-2, M1S2, M4S1, MIC18, TACSTD1, TROP1
Accession P16422
Amino Acid Sequence

Protein sequence (P16422, Gln24-Lys265, with C-10*His) QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 29.1 kDa Observed MW: 32,33 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/ml according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Epithelial cell adhesion molecule (EpCAM), also known as CD326 among other names, is a transmembrane glycoprotein mediating Ca2+-independent homotypic cell–cell adhesion in epithelia. EpCAM is also involved in cell signaling, migration, proliferation, and differentiation. Additionally, EpCAM has oncogenic potential via its capacity to upregulate c-myc, e-fabp, and cyclins A & E. Since EpCAM is expressed exclusively in epithelia and epithelial-derived neoplasms, EpCAM can be used as diagnostic marker for various cancers. It appears to play a role in tumorigenesis and metastasis of carcinomas, so it can also act as a potential prognostic marker and as a potential target for immunotherapeutic strategies.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 68803853175

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
SALLY
Los Angeles, US
★★★★★ 5
Wonderful size and holds the essentials.
Color: A-silver
I have no room for something bigger because I have a drop in sink. This is working wonderful. There is room for a scrubby, sponge my stove top cleaner and scrapper for stove. The tray below to catch any water is great and very easy to remove and drain. It takes a second to do. Great size as it is not huge but holds what I need.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 13, 2026
J
Verified Purchase
jaslin5
Boise, US
★★★★★ 5
Kitchen caddy organizer.
Color: Black
Kitchen caddy organizer is perfectly suited to declutter your kitchen countertop sink area. just the right size to hold a sponge, soap dispenser, and a scrub brush or other utility. Nice design, easy to clean and economical.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 31, 2026
K
Verified Purchase
Kelly S Piddington
Birmingham, US
★★★★★ 3
fair
Color: Black-l
Good caddy, not a fan of the clear water holder. Should be black like the caddy. And maybe another taller area for the sponge
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 18, 2026
O
Verified Purchase
Omari
Bozeman, US
★★★★★ 5
Awesome Product
This item not only looks good but also works well along with being affordable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 16, 2025
A
Verified Purchase
Aran Miller
Charlottesville, US
★★★★★ 5
Recommend this it’s awesome !!!
It’s awesome and it works great. The old one I had from Walmart kept getting clogged. It wouldn’t work right this one has yet to get clogged. It holds two of my sponges that I was hoping it would hold a lot easier to maintain and clean, and the pocket was able to hold both of my scrub daddies.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026

recommand products