SKU: 68631324497

LOX-1/OLR1 His Tag Protein, Mouse

Sale price$271.80 Regular price$302.00
Save 10%

Pay in installments of $75.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 24 - Aug 29

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LOX-1/OLR1 His Tag Protein, MouseProduct Specification Species Mouse Synonyms CLEC8A, CLEC8ASLOX1, LOXIN, OLR1, SR E1 Accession Q9EQ09 Amino Acid Sequence Arg60 Ile363, with N terminal 9*His

Product Specification


Species Mouse
Synonyms CLEC8A, CLEC8ASLOX1, LOXIN, OLR1, SR-E1
Accession Q9EQ09
Amino Acid Sequence

Arg60-Ile363, with N-terminal 9*His HHHHHHHHHRQVSDLLKQYQANLTQQDRILEGQMLAQQKAENTSQESKKELKGKIDTLTQKLNEKSKEQEELLQKNQNLQEALQRAANSSEESQRELKGKIDTITRKLDEKSKEQEELLQMIQNLQEALQRAANSSEESQRELKGKIDTLTLKLNEKSKEQEELLQKNQNLQEALQRAANFSGPCPQDWLWHKENCYLFHGPFSWEKNRQTCQSLGGQLLQINGADDLTFILQAISHTTSPFWIGLHRKKPGQPWLWENGTPLNFQFFKTRGVSLQLYSSGNCAYLQDGAVFAENCILIAFSICQKKTNHLQI

Expression System HEK293
Molecular Weight 45-60kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Sawamura, T. et al. (1997) Nature 386:73. 

2.Daugherty, A. et al. (2000) Curr. Opin. Cardiovasc. Pulm. Ren. Invest. Drugs. 2:223. 

3.Platt, N. and S. Gordon (2001) J. Clin. Invest. 108:649. 3

4.Platt, N. and S. Gordon (1998) Chem. Biol. 5:R193.

Background

Lectin-like oxidized low-density-lipoprotein receptor-1 (LOX-1), also known as oxidized low-density-lipoprotein receptor-1 (OLR-1), is a type II transmembrane receptor belonging to the C-type lectin family. It also belongs to the functionally defined scavenger receptor (SR) superfamily, whose members share the common ability to bind and internalize modified forms of Low Density Lipoproteins (LDL). LOX-1 is the first member of the class E scavenger receptor subfamily (SR-E). It binds and supports the internalization of multiple structurally unrelated macromolecules including oxidized LDL, advanced glycation end products (AGE), activated platelets, bacteria, apoptotic or aged cells, and heat shock proteins. LOX-1 has also been implicated as an intestinal receptor involved in the transcytosis of pancreatic bile salt-dependent lipase. The human LOX-1 gene encodes a 273 amino acid (aa) residue protein with a short N-terminal intracellular domain, a transmembrane domain, an extracellular stalk/neck region followed by a C-type lectin-like domain (CTLD). The CTLD, which is required for ligand recognition, contains the six conserved cysteine residues present in all C-type lectins, but lacks the Ca2+-binding residues found in classical C-type lectins. LOX-1 can be detected on activated endothelial cells, vascular smooth muscle cells, macrophages, intestinal cells and dendritic cells. The expression of LOX-1 is induced by proinflammatory or proatherogenic stimuli, as well as by oxidized LDL itself and hemodynamic or oxidative stress. Human LOX-1 exists on the cell surface as covalent homodimers, which can further associate into non-covalent-linked oligomers. Cell surface LOX-1 can also be cleaved by yet unidentified proteases to release the soluble LOX-1 extracellular domain. Binding and endocytosis of oxidized LDL by LOX-1 induces oxidative stress, activates NF kappa B, and upregulates the expression of monocyte chemoattractant protein-1 and matrix metalloproteases. LOX-1-dependent oxidized LDL uptake also induces apoptosis by inducing the expression of the pro-apoptotic Bax and downregulation of the anti-apoptotic Bcl-2. Oxidized LDL plays a key role in the pathogenesis of atherosclerosis and endothelial dysfunction. Blockade of LOX-1 functions may turn out to be a suitable target for the therapeutic intervention of atherosclerosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 68631324497

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Dee1973
Lexington, US
★★★★★ 5
Appearance, texture, and smell pass the test!
Size: 16 Fl Oz (Pack of 1)
I am rating this product on a appearance, texture and smell alone because I have not had time to use it in order to determine it's hair nourishing properties. I have studied a lot about Botana oil because there are so many products out there that have been born out of a few large names putting it out there in the market. It smells exactly like it should which is coffee and a little bit of Ash. I know that sounds strange but it really is not a bad smell. The texture and the color seem to pass the test as well. The color is a yellow brownish color. The texter is more like a butter as opposed to an oil. It puts you in the mind of shea butter. I did take a little bit out of the jar to see how oily it is and of course it's oily but once you melt it in your hands and rub it in it seems to soak in easily. This protect solid while in the jar. 100% Botana oil should never turn liquidy at all unless you have it in a very hot environment of course. I'll come back once I use the product to determine how it nourishes my hair.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 19, 2025
C
Verified Purchase
catnip
New York, US
★★★★★ 5
Good Product
I love this brand, but haven't been able to find it lately in stores in my area. It's probably the best self tanner I've used overall. Shipping from this seller was pretty quick. Color is believable- even on my pasty pale, next to white skin. If you're like me, you have to be careful of products that turn you orange. With the "dark" shade, you still need more than one application to actually be dark. To me, that's okay because you can control the color. First application gives a nice color, second application gives a deeper tan. However, I may get the ultra dark next time. I love the sprays best because they dry fast, give the best, most even, controllable application and I have better luck with these than lotions. With lotions, you are gooey and sticky and there is more stuff transferring on your clothes. Never wear white anyway when you first apply self-tanner! Best to do it before you go to bed. I really like that it is tinted. Not only do you get an instant, believable color while you wait for the self tanner to do its job, but you can see where it goes so you don't end up with streaks. Because of the tint, place an old towel on the floor as a drop cloth. Wash your hands between applying to body parts to avoid staining your palms. Yeah, the usual Self Tanning 101 stuff. You do end up with a hint of that self-tanner smell and I have used other products that are better as far as this goes, but it's nothing too bad. They all have that smell to some degree or other. Your tan lasts about 4-5 days and is easy to exfoliate off, without flaking off in weird patches. Best of all, this product is cruelty-free and no animal testing!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 25, 2016
V
Verified Purchase
V. White
Whiting, US
★★★★★ 5
A fantastic self tanning product.
I have been using this self tanner for years. So glad Amazon carries it. It's a bit tricky to use and be prepared to use in an area that is protected. Like using a drop cloth and using care with surrounding areas. It also can stain hands and feet so use gloves and cover the bottoms of your feet. The good part after all that is ,a beautiful deep rich tan. I have fooled many using this product. You cannot spray too close or it will run or not go on evenly. It also at times has faulty cans that drip and are messy. Used to that after all this time. The liquid that leaks is green. Now after all that, it does not sound all that appealing but, trying to give some guidance because it is worth the effort. I have heard rumor that it was used on the show Baywatch to give them that true sun kissed bronze look. It literally in one spraying has you tan. You can darken by using every few days. I usually spray it on before bed, let it dry well and wear overnight to let it set up and develop. It has a sort of almond scent so the smell is decent. I will mist my face alone if I just want a bit of color during the colder months before I leave the house . I just mist a bit less and let it dry. Not saying this is the most user friendly product but, will keep working around its faults to keep glowing. Best at home tan as good as a spray tan from a salon.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 19, 2015
S
Verified Purchase
Sandra Jimenez
Dallas, US
★★★★★ 4
Beautiful bronze color!
This is a nice spray mist tan that gradually gets deeper in color within a couple hours after application. It did not make me look orange at all rather a great beach bronze color. It’s a bit difficult to spray my legs evenly all around while staying within the range/ distance it recommends in order to avoid lines, drilling and streaks. Next time I’m asking my friend to spray me. The spray mist on skin will stay on for 3 days before it begins to wear offs. I suggest exfoliating in between spray tanning
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 28, 2019
T
Verified Purchase
The.Masked.Reviewer
West Palm Beach, US
★★★★★ 3
Great self-tanner -- VERY light color
Size: 5 Fl Oz (Pack of 1)
First of all, I must confess -- I am a self-tanning junkie. Okay -- I said it. I have used MANY, MANY self-tanning products over the years. This was the first time I had purchased this brand, and I was pleased. Pleased. Not thrilled. Just pleased. The product delivers nice, good quality color. It has a pleasant feeling on the skin. Smells lovely. My ONLY complaint is this: the color was not dark or deep, which is the #1 thing I seek in a self-tanner. I want deep, dark color -- I want to appear...well....TANNED! This product simply did not deliver the dark color I was seeking. I would definitely recommend this self-tanner to anyone looking for a LIGHTLY COLORED tanning effect. This product delivers a lightly peachy-colored tan. It dries VERY quickly and evenly.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 30, 2022

recommand products