SKU: 68455990498

Human CXCL9/MIG, His tag

Sale price$105.75 Regular price$117.50
Save 10%

Pay in installments of $29.38 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 11 - Sep 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CXCL9/MIG, His tagProduct Specification Species Human Synonyms Gamma interferon induced monokine, Monokine induced by interferon gamma (HuMIG; MIG), Small inducible cytokine B9, CMK, MIG, SCYB9 Accession Q07325 Amino Acid Sequence Protein sequence (Q07325, Thr23 Thr125, with C 10*His) TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTTGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 13. 4 kDa

Product Specification


Species Human
Synonyms Gamma-interferon-induced monokine, Monokine induced by interferon-gamma (HuMIG; MIG), Small-inducible cytokine B9, CMK, MIG, SCYB9
Accession Q07325
Amino Acid Sequence

Protein sequence (Q07325, Thr23-Thr125, with C-10*His) TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTTGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 13.4 kDa Observed MW: 16, 17, 18 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Chemokine (C-X-C motif) ligand 9 (CXCL9) is a small cytokine belonging to the CXC chemokine family that is also known as monokine induced by gamma interferon (MIG). The CXCL9 is one of the chemokine which plays role to induce chemotaxis, promote differentiation and multiplication of leukocytes, and cause tissue extravasation. The CXCL9/CXCR3 receptor regulates immune cell migration, differentiation, and activation. Immune reactivity occurs through recruitment of immune cells, such as cytotoxic lymphocytes (CTLs), natural killer (NK) cells, NKT cells, and macrophages. Th1 polarization also activates the immune cells in response to IFN-γ. Tumor-infiltrating lymphocytes are a key for clinical outcomes and prediction of the response to checkpoint inhibitors. In vivo studies suggest the axis plays a tumorigenic role by increasing tumor proliferation and metastasis. CXCL9 predominantly mediates lymphocytic infiltration to the focal sites and suppresses tumor growth. It is closely related to two other CXC chemokines called CXCL10 and CXCL11. CXCL9, CXCL10 and CXCL11 all elicit their chemotactic functions by interacting with the chemokine receptor CXCR3.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 68455990498

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 11 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Drug Waitress, RN
Los Angeles, US
★★★★★ 5
I hate sunscreens, but...
Style: Kids SPF 50, Size: 3 Fl Oz (Pack of 1)
I hate sunscreen in general--for it's texture and smell. But, being the palest family on Earth makes it a daily necessity. I was pleasantly surprised to actually like the smell of this product! It's a light fruity fragrance. It has a smooth texture like lotion and glided on my skin without being too thick or greasy and no white marks. A little goes a long way too! I could hardly believe I was putting on sunscreen and not regular body lotion. My kids had no issue with it either! They let me put this stuff on their little faces without complaint since it goes on so smoothly. Most importantly, this product did it's job and we were sunburn free. The tube is small--4 ounces--but I don't care because it's so worth having something that goes on easy and doesn't make us greasy and stinky. I bought several tubes--one for each member of the family. *If this review was helpful, please click 'yes' below. Thanks!*
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 14, 2018
J
Verified Purchase
Jill W
Grantham, US
★★★★★ 4
It’s ok
Style: Kids SPF 50, Size: 3 Fl Oz (Pack of 1)
Doesn’t smell like anything, especially not fruit. Seems to work well- it’s what we use on our faces. I started using this all over on my daughter because their spray version is not good.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2019
C
Verified Purchase
Cosmos1
Carnegie, US
★★★★★ 5
Overall this is a very good product
Style: Kids SPF 50, Size: 3 Fl Oz (Pack of 1)
I bought this because every sunblock I own eventually gets in my eyes and burns the living daylights out of them. I prefer to use something that isn't laden with chemicals, is cruelty free and reef safe so this looked like it would fit the bill and indeed, it does. It is a true "no tears" formula which I very much appreciate. As with so many zinc based sunblocks there's still a slight "Kabuki mask" effect but it isn't as bad as some of the other zinc products. I wouldn't go so far as to say it's easy to spread because it doesn't have a lot of "slip", doesn't glide like the non-zinc products. You do have to work with it for awhile to get rid of the decidedly chalky consistency but once you get going it seems to be okay. I think somebody else mentioned using a moisturizer before you put it on which seems like good idea even though this is supposed to be moisturizing. Would I purchase this again? I'm pretty sure I will because the "no tears" aspect of the product is important to me. I'll probably use it with a light carrier oil on my face first, let that oil sink in and then put this on top. I'll keep you posted on how that works out. Thank you, Alba Botanica, for being cruelty free and reef safe!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 22, 2020
S
Verified Purchase
SK22
Pawtucket, US
★★★★★ 5
Thank you for making this
Style: Kids SPF 50, Size: 3 Fl Oz (Pack of 1)
I have the most sensitive reactive skin. I regularly will breakout to products that are supposed to be hypoallergenic and non-clogging. I have used this product multiple times and have not had one issue. I also burn in literally 2 mins and I live in Las Vegas. This protected me and my skin did not react. It absorbed in like regularly lotion not leaving any white cast or sticky feeling. There was no scent which is SO important. I wore it only in the sun not swimming so I cannot comment on how well it works under those conditions. I will by this again without hesitation. If you are in need of a high quality sun protector and have skin like a baby or you are a baby this is the best.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 7, 2026
W
Verified Purchase
Winta
Los Angeles, US
★★★★★ 5
Love
Style: Kids SPF 50, Size: 3 Fl Oz (Pack of 1)
It’s nice I love it both me and my daughter we use it it don’t make you white it don’t stick it’s not greasy I love it
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 20, 2026

recommand products