SKU: 68090964206

Mouse IFN-alpha1 Protein, His Tag

Sale price$31.50 Regular price$35.00
Save 10%

Pay in installments of $8.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 23 - Aug 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse IFN-alpha1 Protein, His TagProduct Specification Species Mouse Synonyms Interferon alpha 1, IFN alpha 1, Ifna1 Accession P01572 Amino Acid Sequence Protein sequence (P01572, Cys24 Lys189, with C His Tag) CDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSSAAWNTTLLDSFCNDLHQQLNDLQGCLMQQVGVQEFPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSANVLGRLREEK Expression System HEK293 Molecular Weight Predicted MW: 20. 8 kDa Observed MW: 20 kDa Purity 95% by SDS PAGE

Product Specification


Species Mouse
Synonyms Interferon alpha-1, IFN-alpha-1, Ifna1
Accession P01572
Amino Acid Sequence

Protein sequence (P01572, Cys24-Lys189, with C-His Tag) CDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSSAAWNTTLLDSFCNDLHQQLNDLQGCLMQQVGVQEFPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSANVLGRLREEK

Expression System HEK293
Molecular Weight Predicted MW: 20.8 kDa Observed MW: 20 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Interferon alpha-1 is a member of the type I interferon family that is produced in response to viral infection as a key part of the innate immune response with potent antiviral, antiproliferative and immunomodulatory properties. This cytokine, like other type I interferons, binds a plasma membrane receptor made of IFNAR1 and IFNAR2 that is ubiquitously expressed, and thus is able to act on virtually all body cells. This cytokine is upregulated in preeclamptic placentas and is thought to be a mediator of preeclampsia.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 68090964206

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 6 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
DJ SINGH
Fort Morgan, US
★★★★★ 5
good
Size: 23.6 Inch, Color: White
I recently added this bathroom shelf, and it’s been a great upgrade for organizing my space. It was easy to install and feels sturdy enough to hold everyday essentials like toiletries, skincare products, and small containers without any issues. The design is simple and clean, which helps it blend in nicely with the rest of the bathroom. It doesn’t take up much space but still provides enough storage to reduce clutter around the sink or shower area. One thing I appreciate is how practical it is for small bathrooms—everything is within reach, and it makes the space feel more organized overall. As long as it’s installed properly, it holds up well and stays secure. The only downside is that heavier items might not be ideal depending on the material, but for regular use, it does the job perfectly. Overall, a functional and affordable solution if you’re looking to add extra storage and keep your bathroom tidy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026
A
Verified Purchase
Ashlee
Phoenix, US
★★★★★ 5
Perfect!!
Size: 23.6 Inch, Color: Rustic Brown, Size: 23.6 Inch, Color: Rustic Brown
Easy to hang and stunning!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026
A
Verified Purchase
Amber
Los Angeles, US
★★★★★ 5
Good quality shelves
Size: 23.6 Inch, Color: White, Size: 23.6 Inch, Color: White
Very good quality. Easy to install. Love them in my bathroom.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2026
S
Verified Purchase
soma
Los Angeles, US
★★★★★ 4
Very spacious and beautiful
Size: 23.6 Inch, Color: White, Size: 23.6 Inch, Color: White
A lot of my books fit on here and there’s still more room left if I wanted to buy more books. It’s a simple looking bookshelf but it’s really pretty. It’s also sturdy the only reason I gave it a 4 stars instead of 5 was because it comes with its own plastic screw anchors and they are crap. The shelves were wobbly when we installed them using the plastic screw anchors that came with the packaging. My dad set mine up and luckily he had a bunch of his own so he switched them out with better screw anchors. Once we made that switch it was perfect, there was no wobble or shaking at all. So that’s my only piece of advice. Besides for the screw anchors everything else is perfect
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 25, 2024
B
Verified Purchase
BWW
West Palm Beach, US
★★★★★ 5
Easy to install
Size: 23.6 Inch, Color: White
Super easy to install. I use different wall anchors. The anchors like all anchors that come with shelves are not great. The shelves look very clean on the wall.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 31, 2026

recommand products