SKU: 66500586971

Human TMEM119, His tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 11 - Sep 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human TMEM119, His tagProduct Specification Species Human Synonyms Osteoblast induction factor (OBIF) Accession Q4V9L6 Amino Acid Sequence Protein sequence (Q4V9L6, Thr118 Val283, with C 10*His) TRQKQKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDSRPEEALDSSRQLQADILAATQNLKSPTRAALGGGDGARMVEGRGAEEEEKGSQEGDQEVQGHGVPVETPEAQEEPCSGVLEGAVVAGEGQGELEGSLLLAQEAQGPVGPPESPCACSSVHPSVGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Predicted MW: 19. 1 kDa Observed MW: 30 kDa Purity 90% by

Product Specification


Species Human
Synonyms Osteoblast induction factor (OBIF)
Accession Q4V9L6
Amino Acid Sequence

Protein sequence (Q4V9L6, Thr118-Val283, with C-10*His) TRQKQKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDSRPEEALDSSRQLQADILAATQNLKSPTRAALGGGDGARMVEGRGAEEEEKGSQEGDQEVQGHGVPVETPEAQEEPCSGVLEGAVVAGEGQGELEGSLLLAQEAQGPVGPPESPCACSSVHPSVGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Predicted MW: 19.1 kDa Observed MW: 30 kDa
Purity >90% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

TMEM119 is known as a microglia-specific and robustly expressed trans-membranous molecule, which is not expressed by other macrophages and immune or neuronal cells, and forms, therefore, the most promising microglia marker to date. TMEM119 has served as a reliable immunohistochemical microglia marker for neurodegenerative diseases since then and was recently stained by an adapted protocol for immunocytochemistry even in postmortem CSF samples of trauma cases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 66500586971

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Robert McDonald
Omaha, US
★★★★★ 5
Very nice at a nice price.
Color: White, Size: 35 Inch, Style: 2 Pack, Color: White, Size: 35 Inch, Style: 2 Pack
Very easy to mount on the wall. Very sturdy with about 10-12 lbs on each shelf. Only took about 15 minutes to hang each one.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026
C
Verified Purchase
Cherry Lynn
Pawtucket, US
★★★★★ 5
Cat playground
Color: Black, Size: 35 Inch, Style: 3 Pack, Color: Black, Size: 35 Inch, Style: 3 Pack
Easy to install. Sturdy enough for 2 large rambunctious kitties to play on and look very nice. I was working on a vertical play space for the cats and since these come in many sizes it worked great. I did add grip tape to some.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
A
Verified Purchase
Amazon Customer
Houston, US
★★★★★ 3
Not the best quality
Color: Rustic Brown, Size: 35 Inch, Style: 2 Pack, Color: Rustic Brown, Size: 35 Inch, Style: 2 Pack
The shelving unit was not as I had expected. It arrived damaged. The damage is on the under side though. They are hollow and not hardwood as I had expected. Save your money if you want something of good quality. These are like 3 pieces of pressed wood glued together. They are space saving and look great in my space. The mounting hardware it comes with was plenty enough to hang these but make sure you hang them in the studs if at all possible. Assembly was simple. It does come with a micro level. Which a kid or pet could accidentally swallow. It’s like pill capsule sized so just be careful when opening the package.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
A
Verified Purchase
Amazon Customer
Bozeman, US
★★★★★ 5
Love these and will be getting more. Very pretty.
Color: Oak, Size: 39.4"L x 8"D, Set of 2, Color: Oak, Size: 39.4"L x 8"D, Set of 2
Very nice shelves they look great up and were easy to install. Same color shown in picture. They seem very sturdy on the wall and I love the look of them. They are light weight and a good size just a little plunder 40 inches. Good quality for the price. I'll be buying again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 25, 2026
M
Verified Purchase
Myers3
Bozeman, US
★★★★★ 5
PERFECT!
Color: Walnut, Size: 23.6"L x 8"D, Set of 2, Color: Walnut, Size: 23.6"L x 8"D, Set of 2
Just as good as expected! Great quality, no issues. Easy to construct and look amazing!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2026

recommand products