SKU: 66069944694

CD79A His Tag Protein, Human

Sale price$234.00 Regular price$260.00
Save 10%

Pay in installments of $65.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD79A His Tag Protein, HumanProduct Specification Species Human Synonyms CD79A, Ig alpha, MB 1 membrane glycoprotein, Membrane bound immunoglobulin associated protein, Surface IgM associated protein Accession P11912 Amino Acid Sequence Leu33 Arg143, with C terminal 8*His LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRGGGSHHHHHHHH Expression System HEK293 Molecular Weight 35 46kDa Purity >95% by SDS PAGE Endotoxin

Product Specification


Species Human
Synonyms CD79A, Ig-alpha, MB-1 membrane glycoprotein, Membrane-bound immunoglobulin-associated protein, Surface IgM-associated protein
Accession P11912
Amino Acid Sequence

Leu33-Arg143, with C-terminal 8*His LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

35-46kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Venkitaraman A R. et al. (1991) The B-cell antigen receptor of the five immunoglobulin classes. Nature. 352(6338): 777-781.

2、Kim K M. et al. (1993) Signalling function of the B-cell antigen receptors. Immunol Rev. 132: 125-146.

Background

CD79A encodes CD79a (also known as Ig-α) belonging to the Ig superfamily, a transmembrane protein that associate with CD79a(Ig-β) via a disulfide bond. CD79A and CD79B encoded by the mb-1 and B29 genes, respectively. CD79A and CD79B are proximal B-cell receptor subunits that contain an immunoreceptor tyrosine-based activation motif (ITAM) that frequently harbors somatic mutations. Ig-α and Ig-β form a disulfide-linked heterodimer that associates with membrane-bound Ig (mIg)3 molecules of every Ig class to form the B cell Ag receptor (BCR) complex. The variable region of the H and L (IgH and IgL) chains of the mIg molecules constitute the Ag-binding portion of the BCR, whereas the Ig-α/Ig-β heterodimer is its signaling component.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 66069944694

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Abby L
West Palm Beach, US
★★★★★ 5
Easy to edge with
Size: 8" Edger New
This works great to edge an overgrown area like sidewalk and driveway. Super effective and easy to use.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
M
Verified Purchase
M. M. Bowden
Waukegan, US
★★★★★ 5
GREAT 80v edger (but Kobalt users beware)
Size: 8" Edger Gen1, Size: 8" Edger Gen1
This Greenworks 80v edger is fantastic. I was surprised at how sturdy and rigid the shaft is - much more so than the very much more expensive Stihl Brushcutter I used for years. I like the adjustability of the blade depth and the power is impressive. You will get more run time with higher amp batteries - I have both 2.0 and 2.5 amp batteries, but if you have multiple batteries and chargers (from acquiring multiple tools) you will never be waiting for a battery to charge. If you have only purchased Greenworks tools, then you are golden. BUT HERE IS THE RUB IF YOU, LIKE ME, THOUGHT THEY WERE STRAIGHT-ACROSS COMPATIBLE WITH THE SAME LINE OF TOOLS THEY MANUFACTURED FOR LOWE'S UNDER THE KOBALT MONIKER AND BLUE COLOR, AS DIFFERENTIATED FROM THEIR STANDARD BRIGHT GREEN. One of the reasons I went ahead and committed to buying the Kobalt line of 80v yard tools was because Greenworks made them and I figured that it would be a long-lasting and stable design platform, being the same 80v system across two different brands. Then Lowe's dropped the 80v line. I was able to get a few more of their tools for great clearance prices and looked forward to switching over to the complete line of Greenworks 80v tools. was very happy to be able to order their edger because it's the exact same power system - just that all of my gear is Kobalt blue. AND HERE IS THE DEAL WITH THAT: They are different. The Kobalt 80v battery will not fit/slide into the Greenworks 80v battery compartment/housing (*as manufactured). - I guess I shouldn't have been surprised - and it could have been Lowe's that required that the stuff made for them specifically would be incompatible. But since it's the same power system, I wondered what the difference was and if I could work-around their obstructionist corporate bs. What I discovered was that the battery compartment on the tools have two long molded channel-guides (male) that match the two long molded (female) channels in the batteries. The vertical placement of the bottom 'rail' in the tool/compartment is positioned in a slightly different spot between the Kobalt and Greenworks 'brands'. But this actually works, because I just used a hand chisel and removed the 'bottom' rail from the Greenworks tool/edger. WA-LA - EUREKA!!! It worked great! It's a great fit, the top rail is more than enough to hold the battery stably in position and the 'lock' mechanism functions perfectly! I am looking forward to buying more tools in the Greenworks 80 volt line without having to replace all of the Kobalt tools I already paid for AND ESPECIALLY the rediculously expensive batteries...
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 29, 2021
R
Verified Purchase
Ryan
Louisville, US
★★★★★ 4
Great product that makes edging very fast
Size: 8" Edger New
Edging was quite a job because I had to do it with a hand tool. I have quite a few Greenwork tools, so I decided to purchase the edger. It works great and I am in general happy with it. The three downsides for me are that tool is quite heavy when it also has the battery in it, that the metal blade decreases in size rapidly because of the friction when edging near concrete, and that the wheel is in such a position that I have to bend substantially while the blade does not edge deep enough so that I have to lean the tool on the metal strip at the bottom of the tool.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 17, 2025
R
Verified Purchase
rebecca hansen
Lake Worth, US
★★★★★ 5
Very pleased
Size: 8" Edger New
Works well and gives a nice clean line. I am able to take care of the overgrown edges very fast.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026
C
Verified Purchase
Charles Sebastian
Lexington, US
★★★★★ 5
Plenty of power. Easy to use.
Size: 8" Edger New
I was amazed at the power of this edger. Due to health issues we couldn’t give our lawn adequate attention. It hadn’t been edged in over a year. This edger cut thru the heavy overgrown grass. Maintaining the edging now is a breeze. It uses the same 80 volt battery as my blower👍. The only negative is there is no edge guide, but once I got used to it, it’s not really needed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026

recommand products