SKU: 62426405680

Cystatin-C His Tag Protein, Human

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Cystatin-C His Tag Protein, HumanProduct Specification Species Human Synonyms Cystatin CCystatin CCystatin 3CST3 Accession P01034 Amino Acid Sequence Ser27 Ala146, with N 6*His MHHHHHHDDDDKSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA Expression System E. coli Molecular Weight 14. 9 kDa(Reducing) Purity 95% by SDS PAGE Endotoxin <2EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder

Product Specification


Species Human
Synonyms Cystatin-C,Cystatin C,Cystatin-3,CST3
Accession P01034
Amino Acid Sequence

Ser27-Ala146, with N-6*His MHHHHHHDDDDKSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

Expression System E.coli
Molecular Weight 14.9 kDa(Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <2EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris, 100mM NaCl, pH8.0
Reconstitution Reconstitute at 0.1-1mg/mL according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Human cystatin C (hCC) belongs to a family of proteins called cystatins. There are three distinct types of cystatins that share sequence and structure homology but differ in size, site of action, and disulfide bond topology. Human cystatin C belongs to the type 2 cystatins that are generally secreted as extracellular polypeptides. hCC is broadly distributed and found in most body fluids. This small protein consists of 120 amino acids forming a single polypeptide chain. Cystatin C contains four conserved cysteine residues that can form two disulfide bonds but, unlike other family members, was neither shown to be glycosylated (cystatin E/M and cystatin F) nor phosphorylated (chicken cystatin). Furthermore, hCC can be found in monomer, dimer, oligomer, and fibril states.

In terms of biological function, hCC is a target of proteolysis, and primarily functions as a protease inhibitor. It is degraded by cathepsin D and elastase.Uncontrolled proteolysis leads to an imbalance between active proteases and endogenous inhibitors,eventually leading to disease.The hCC concentration in blood correlates with the glomerular filtration rate(GFR), an important marker of kidney health and the progression of diabetes, chronic kidney disease.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 62426405680

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 20 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Avid Reader
New York, US
★★★★★ 5
Fun for kids and those kids at heart!
Format: Paperback
When I was a kid around 8 or 9 years old, we would go to an outdoor theatre, a special treat. I remember the old 1960's era Batman movies playing on the screen. It was fun, exciting, heroic...all those things that made it pure enjoyment. When I think of recent Batman movies that have turned dark, deadly, desperate, all the fun has gone out of those experiences and I simply don't watch those movies. This is simply a long way of saying that this book, Bruce Wayne: Not Super, brought back all the fun I experienced as a kid. Here we have our hero, who doesn't think he is, who compares himself to everyone around him with supernatural abilities, and begins to grow desperate. The background story is essentially the same: dead parents, rotten town, etc. But we see life from his perspective and can root for him all the way. He goofs up, makes lots of mistakes and this makes him even more lovable. This book is prefect for readers young and old, and if this made into a movie, I guarantee you that I would watch it. Highly recommended.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 4, 2024
M
Meg Christine
Massapequa, US
★★★★★ 5
Fun Story For Any Age Fan
Format: Paperback
Bruce Wayne is the only kid at his middle school without some kind of special powers. He wants to make a difference in Gotham but he thinks he doesn’t stand a chance compared to all of the other students with impressive skills. Bruce Wayne: Not Super follows Bruce’s journey to finding out what makes him special. This middle grade graphic novel is very well done. I was already familiar with much of the author, Stuart Gibbs’ work. His style and sense of humor carry over well to this type of comic. The illustrations pair nicely and are done in a lighter style than more adult Batman comics. Bruce Wayne: Not Super would be a good introductory book for younger Batman fans or a fun addition for collectors of any age to add to their stash. I don’t know if the author has worked with DC before but I’d love to see more collaborations in the future for more middle grade graphic novels. I voluntarily read and reviewed an advanced copy of this book. All thoughts and opinions are my own. Thank you to NetGalley and DC Entertainment (DC Comics)!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 17, 2023
M
Mark Baker - Carstairs Considers
Boise, US
★★★★★ 5
Fun Middle School Origin Story
Format: Paperback, Format: Paperback
Bruce Wayne stands out at his middle school, Gotham Preparatory School for the Really, Really Gifted. No, not because of the wealth he’s inherited from him parents but because he’s the only one without any powers. But when he sees a student bullying another kid, he decides he has to do something. Will he come up with a plan? This is a fun alternative take on Batman’s origins including cameos from other DC super heroes. The story was entertaining, and I laughed multiple times as I was reading. Be sure to look at the illustrations since some of the jokes are in there. This graphic novel is a very fun read.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 18, 2023
B
Booklover3
Whiting, US
★★★★★ 5
Stunning graphics and a relatable hero
Format: Paperback
As Stuart Gibbs is one of my favorite middle grade authors, I was eager to pick up this book. It did not disappoint. Stunning graphics and a relatable protagonist make this an engaging read. Full of references to the world of superheroes, (some sneaky, some overt) there were plenty of opportunities to make inferences and share a snide chuckle with the author. This title is now on the short list for next year’s Battle of the Books in our school district. Kudos to Stuart Gibbs for the message of brain over brawn (and superpowers)!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 24, 2024
P
Phillip Quinn
Boise, US
★★★★★ 4
Bruce Wayne: Not Super | Comic Review
Format: Paperback
I recently had the opportunity to check out Bruce Wayne: Not Super from DC Comics. The story is from Stuart Gibbs and the artwork is from Berat Pekmezci, and it is obviously about Batman. The middle-grade graphic novel follows a teenage Cape Crusader going to school with every other DC character. Heroes and villains all going to school together is a funny concept that I think is pulled off well here. What’s the joke about Batman? He’s just a rich kid with no powers, so what happens when he goes to a prep school with Superman, Wonder Woman, Flash, Green Arrow, etc.? Bruce has to come to grip with having no powers and how that affects his daily interactions with his classmates. Bruce’s alienation at being powerless directly conflicts with his goal of being a vigilante hero for Gotham City. His camaraderie with Dick Grayson (Robin) helps him work through his feelings on wanting to be Ferretman Batman. Aging adult characters down to young teens can come with their own difficulties, but I think Pekmezci nailed it. The artwork is very good throughout this book. It may not be everybody’s cup of tea, but I really dig these “Elseworlds” stories that place the heroes in completely weird situations. And, what’s weirder than a middle/high school full of super-powered kids! Clearly, I wasn’t the intended audience for this book, but I think those kids will have a great time reading this.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2024

recommand products