SKU: 62359811392

EphB1 His Tag Protein, Human

Sale price$374.40 Regular price$416.00
Save 10%

Pay in installments of $104.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

EphB1 His Tag Protein, HumanProduct Specification Species Human Antigen EphB1 Synonyms ELK, EPHT2, Hek6, NET Accession P54762 Amino Acid Sequence Met18 Pro540, with C terminal 10*His Tag MEETLMDTRTATAELGWTANPASGWEEVSGYDENLNTIRTYQVCNVFEPNQN

Product Specification


Species Human
Antigen EphB1
Synonyms ELK, EPHT2, Hek6, NET
Accession P54762
Amino Acid Sequence

Met18-Pro540, with C-terminal 10*His Tag MEETLMDTRTATAELGWTANPASGWEEVSGYDENLNTIRTYQVCNVFEPNQN NWLLTTFINRRGAHRIYTEMRFTVRDCSSLPNVPGSCKETFNLYYYETDSVIATKKSAFWSEAPYLKVDTIAADESFSQVDFGGRLMKVNTEVRSFGPLTRNGFYLAFQDYGACMSLLSVRVFFKKCPSIVQNFAVFPETMTGAESTSLVIARGTCIPNAEEVDVPIKLYCNGDGEWMVPIGRCTCKPGYEPENSVACKACPAGTFKASQEAEGCSHCPSNSRSPAEASPICTCRTGYYRADFDPPEVACTSVPSGPRNVISIVNETSIILEWHPPRETGGRDDVTYNIICKKCRADRRSCSRCDDNVEFVPRQLGLTECRVSISSLWAHTPYTFDIQAINGVSSKSPFPPQHVSVNITTNQAAPSTVPIMHQVSATMRSITLSWPQPEQPNGIILDYEIRYYEKEHNEFNSSMARSQTNTARIDGLRPGMVYVVQVRARTVAGYGKFSGKMCFQTLTDDDYKSELREQLPGGGSGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight 60-72kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Wenqiang Wei, Shaoping Ji. Paradoxes of the EphB1 receptor in malignant brain tumors. Cancer Cell Int. 2017 Feb 8; 17:21. eCollection 2017.

Background

Eph receptors are a subfamily of receptor tyrosine kinases. Eph receptor-mediated forward and ephrin ligand-mediated reverse signalings are termed bidirectional signaling. Increasing evidence shows that Eph/ephrin signaling regulates cell migration, adhesion, morphological changes, differentiation, proliferation and survival through cell-cell communication. Some recent studies have started to implicate Eph/ephrin signaling in tumorigenesis, metastasis, and angiogenesis. Previous studies have shown that EphB1 receptor and its ephrin ligands are expressed in the central nervous system. EphB1/ephrin signaling plays an important role in the regulation of synapse formation and maturation, migration of neural progenitors, establishment of tissue patterns, and the development of immune organs. Besides, various recent studies have detected the abnormal expression of EphB1 receptor in different brain tumors. However, the underlying molecular mechanisms of EphB1/ephrins signaling in the development of these tumors are not fully understood.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 62359811392

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 21 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
bauhaus78
Omaha, US
★★★★★ 5
Finally, A Great Trackball for Macs
After reading the other Amazon reviews, I thought I would respond to some of the issues other reviewers raise from a Mac user's perspective. I run a new PowerBook 15" with OS X 10.3.2. Unlike some other reviewers, I didn't notice any directional/orientation problems--the cursor follows the ball movement very well, even before installing the included Logitech software. Perhaps the necessary drivers are now universally available, or perhaps the Mac version is just better. Also, the "finger layout" has not proven to be an issue for me--I can use any or all of my fingers to control the ball without any cursor-direction problems. The wireless function has proven flawless on my Mac. The reciever is a couple feet away and actually off the desk (no line of sight) and works fine. It was essentially plug-and-play on the Mac--I didn't even have to push the 'Connect' buttons to establish a signal, it just worked. The software is necessary, however, to re-assign new functions to the several buttons on this model. As a former PC user, I can't go without a right-click button (one of the reasons I bought an external device for my notebook at all). The Mac software is very easy to use, and one can re-program all of the buttons and the wheel if one so desires. You can set a button to automatically double- or triple-click, or select keyboard shortcuts (e.g., Command and W to close the current window). Very easy, and quite useful--I use buttons to close windows, quit programs, delete files, and still have a handy web-browsing 'Back' button. The only possible drawback to the Mac software is that one cannot "train" the ball's orientation (from what I can gather from other reviews, this option is not available on PC either). This really only matters if you know you hold trackballs at a different angle than most people do. Please note that the software I'm reviewing is for Mac OS X only; the program for those running OS 8.6-9.2 is a different piece of software, which is also included in the package. Those are all the Mac-specific comments I can think of at this point; if you're a Mac-user you're probably used to things "just working," and this device is no exception. I'll also comment on some of the more universal issues raised by other reviews: Ergonomically, there is a period of adjustment--anyone moving from a conventional mouse to any trackball or from one trackball to another should expect that. It's never a bad idea to try one out in-store to see how they feel, especially since trackball models vary from one to another much more than mice do. This is not, as some have termed it, a 'disadvantage'--all new things take some time to get used to. If you've never used a trackball, it's weird for a while; it's also ergonomically superior/healthier in the long term. Also, I use trackballs for computer drafting/design, and find superior control to mice--finger-control is just more precise than either thumb-controlled trackballs or wrist/arm-controlled mice. The optical ball-tracking technology requires almost no cleaning, and there are zero moving parts to clean. Just pop the ball out and blow any collected lint out of the socket if necessary--which very rarely is. For any pointing device that's wireless, optical, and has this many buttons, this price is pretty decent--lower, I think, than my previous trackball that was wired and lacked the wheel. As for Logitech's reputation/reliability, I have had good experiences. My first trackball had to be replaced during the warranty period, but its replacement has lasted the four years since--I only replaced it now because it wasn't Mac-compatible. Now Mac-users can rejoice with a high-performance trackball that works seamlessly in OS X.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 11, 2004
P
Verified Purchase
P. Lucas
Natrona Heights, US
★★★★★ 5
A treasure that desperately needs a reboot.
I love this mouse. I greet it every morning and give it warm caresses as I drink my morning coffee. I catch myself staring longingly at it daydreaming of using it sitting on a beach sipping a drink with an umbrella. I call her Bridgette. Is she perfect? Probably not - otherwise they'd still be a lot more popular. Is she perfect for me? Yeah. She is. So first the bad and then the good: This mouse is big. For folks with normal to big sized hands, that's a win in a world of tiny mice built for Hobbits. If you have the hand size of a large doll could you still manage it? Yes. It's not THAT big. The surface finish is...temporary. Dynamic. Fluid. I think of it more as patina at this point. Most of the painted surfaces (except for the left click button) on mine are still the same color they were when I bought it. I seem to remember a "soft touch" satin coating on the black parts but that has worn off mine years ago. She still turns heads though. Some people say that these mice have reliability issues. We've been together for a good 17 years and she's still going strong. There was a scare recently where her buttons stopped working but a careful dose of electrical contact cleaner in the switches and a few hours rest and she was right as rain. She's not bullet-proof but hopefully will be around another score or so before parting for good. What I love about this mouse is the feel. It's just right. Trackball people are a finicky group and rarely do we find something that suits us to little complaint. The size of this mouse fits me perfectly. All the buttons are where they should be, I don't have to strain and move and fight to make stuff happen. There's enough flexibility in programming the buttons you can set it to do most tasks easily with one click. It's not so complex that it introduces unwanted drama in your life trying to figure out the minutiae of endless setup options. The trackball is perfectly placed. It's far enough forward my fingertips don't have to hunt for it and just enough to the side that I don't have to twist my wrist to reach it. I can swipe easily from one side of the screen (or across screens) without a thought but still have enough control to be precise when needed. All without straining my wrist. I like the action of mouse clicking left/forward/back with my thumb as it's more natural than the thumb-driven trackballs. I either suffer from twitchy thumb or it's just a bad design for precise movement. The right click button is naturally placed just to the underside of the trackball and feels effortless to click with my ring finger. The scroll wheel is small but cushy and comfortable. There are soft indents to the scrolling so it doesn't get away from you. If you prefer the smooth scrolling feel the "cruise" buttons above and below get that done easily. The drag lock button can come in handy if you're constantly copying multiple files back and forth. I generally don't so it's easily remapped in the software. Battery life is really good. I usually go several months on a set of cheap AA's. It has an auto sleep function instead of a power switch which is handy. The nice thing about AA batteries is that you can easily find them anywhere. I think that's one of the main reasons mine has lasted so long. Dear Logitech or any other company that may stumble across this - please bring this model back with a reboot. People obviously loved it and they sell like hotcakes. I've seen used ones go for upwards of $400 now. Surely there's some profit in doing another run of these beauties!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2021
M
Verified Purchase
M. Turner
Lowell, US
★★★★★ 5
Simply the best input device I've ever used
I've been a long time fan of trackballs - most especially and specifically those made by Logitech. About five years ago I started having pain in my wrists from the constant side-to-side motion of using a mouse. I picked up a Logitech Marble Mouse and loved it for years. It instantly helped by wrist issues and I didn't get so strained and hardly ever got soreness. The only thing I didn't like was that there weren't enough buttons. I envied things like a scroll wheel found on regular mice. The thumb trackball was horrid in my thought (all that stress where your thumb meets the wrist; Ouch!) but had the extra buttons I longed for. Then this one came along. Wow. I saw it in the store and I'll admit, I was a bit intimidated at first. Did I need a cordless? Could I get used to moving it with my hand in a slightly different position? And I know I wanted buttons, but woah, there's a LOT of buttons on it! I played with it and daydreamed about it. I finally ended up getting it for my birthday in May 2003. It honestly did take me a few days to adjust to the change (even from one Logitech trackball to another), but now I can't imagine ever going back. The sheer convenience of being able to not only left-click/right-click, but scroll AND easily go Forward and Backward through webpages with a click of a button amazes me everytime. Trackballs already cut down the amount of round-about pointing you need to do by making it much smoother and easier because of less motion required, but this cuts it down way more then that. Some thoughts from other reviews: *Lefties -- I'm sorry, but it really is designed for a right-hander. Like most mice/trackballs on the market today, they aim for the majority. It's usable on short term for lefties (my boyfriend's a southpaw and he can maneuver it, but couldn't really use it every day, day-in/day-out). HOWEVER, a nice option is the Logitech Marble Mouse since it is neither left nor right hand specific. * Cordless issues -- I've had ZERO interference with it and I have a USB Wacom tablet as well as digital camera hookups and other usb items in my usb hub. NEVER a problem. The manual recommends that if you have problems, move the receiver away from the monitor. Mine sits two or so feet away and works perfectly. * Battery life -- WONDERFUL. Mine went for about five months or so on the original batteries it came with. And I am a hard-core user, driving my trackball way over ten hours a day. The program even warns you on-screen that your batteries are getting low. How cool is that? You don't have to wait until things die leaving you without a mouse, wondering what went wrong - it tells you! * Weight of ball -- I have to say that one of the best aspects of the Logitech trackballs is that the ball spins VERY smoothly and easily. It's also not heavy. This sounds weird until you try one of the HORRID Kensington ones which has such a heavy ball that you literally get fatigued fingers from trying to push the darned thing around the screen. It's such a battle with inferior ones whereas, with the Logitech ones, it's easy. I can zoom around the screen as fast as I wish with the slightest touch of my fingertips (*note: the speed and such can also be edited if you like a slower cursor, but it still will have the lightweight Logitech is known for) * Range of Use -- I agree with another user here - this thing has a range that's far more then you'd need. I sometimes use it on my lap and can stand up and control it from several feet away. * Cleaning -- IMPORATANT. Every now and then, pop the ball out (by pushing from underneath) and clean the gunk which gets on the points the ball rests on. It will help keep your ball rolling smoothly. In sum: ergonomic, comfortable, works great and a real Logitech winner. Well worth the cost.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 6, 2003
S
Verified Purchase
Stanley Chen
Port Orchard, US
★★★★★ 3
Great, yet, not so great
I never bother leaving reviews, but this one gave me an opinion that was strong enough that I had to say something. Much like many other reviews out there, a lot of people complain about the placement of the buttons. Actually I think for the most part everything is fine except for the scroll wheel and the default left click. My problem with those two is, if you're using your index finger to use either feature, you have to really stretch your finger outwards to access it. If you tilt the whole device so that it reaches more easily, then the thumb buttons are now at an odd position. I do have to say though, I originally thought that a non vertical hand position would kill my wrist but surprisingly it didn't. It didn't save my wrist either. But creating finger pains isn't exactly a good alternative due to the uncomfortable positioning. Yes I know you can remap the buttons to different functions but that's settling for less as that means you're opting out on using the uncomfortable buttons. A quick little history on my previous devices. I've used regular mice like everyone else before all these problems creeped up on my hands. The most comfortable regular mouse for me is the logitech mx revolution. But eventually using that started to cause pain. I then moved onto the evoluent vertical mouse 3. That mouse is great and I still use it depending on what I need it for. However I recently ordered the zero tension mouse and I find that for overall usage, that one is the most comfortable since your wrist is at its most relaxed state. No twisting of any kind. Not only that, the fingers curl naturally along the device to reach the buttons. Some people palm their mice leaving their fingers straight, but for others with longer fingers it's a bit difficult to use a mouse without curling your fingers backwards a bit to accommodate positioning. What is the whole point of that long paragraph? This trackman doesn't allow your hand to be in a resting state and *may* cause more strain, or a different type of strain in addition to whatever problem you may already experience. While it sounds like I'm claiming that this is the worst pointing device ever, I'm just stressing on the bad points. It's definitely a solid piece of technology. Doesn't feel cheap, the ball is super easy to clean along with the insides where some dust may collect. All the buttons feel solid. Overall it's got heft so that the whole thing doesn't slide around during use. But build quality and maintenance takes a backseat if comfort isn't there.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 22, 2010
M
Verified Purchase
Mesa Mountain Gal
Whiting, US
★★★★★ 4
Macho Macho Mouse!
This is the biggest mouse ever! At least the biggest I have ever seen or held. It is more like a large rat than a mouse. It was a bit too large for my petite/medium sized hand (I should have read the dimensions more carefully). I did not like the long cord it came with, and the device at the end of it for wireless capability - not very portable. The lock button malfunctioned and just quit working. The scoll buttons are too close together for me and too small. The ball was nice and smooth, but it did not ease the pain in my hand as I had expected. But I have inflamation issues. If a smaller one were available, it might have worked better for me, but the design/layout of some buttons didn't work for me. I surmise that this mouse works superb for men or women with large hands. But it was just not a good fit for me or my work area, and it malfunctioned. I ended up buying and loving... My husband, who is utterly finickly about his mice, actually found this one comfortable and easy to use. The biggest reasons for a trac ball mouse are 1) it works nicely by my side when laptopping on my bed-top - no need to move the mouse around, only the trac ball. 2) The ball and buttons do not cause inflammation in my hands.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 12, 2009

recommand products