Pay in installments of $95.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 26 - Aug 31
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
GIPR His Tag Protein, HumanProduct Specification Species Human Accession P48546 1 Amino Acid Sequence Arg22 Gln138, with C terminal 8*His RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQGGGSHHHHHHHH Expression System HEK293 Molecular Weight 25 34 kDa(Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7. 4
Product Specification
| Species | Human |
| Accession | P48546-1 |
| Amino Acid Sequence | Arg22-Gln138, with C-terminal 8*His RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 25-34 kDa(Reducing) |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
Glucose-dependent insulinotropic polypeptide receptor (GIPR) are G protein-coupled receptors belonging to the secretin receptor super-family, also known as class B1. GIPR comprises an N-terminal extracellular domain (ECD), a central domain consisting of seven transmembrane α-helices, and a C-terminal, cytoplasmic domain that mediates intracellular signal transduction by physical association with the G protein. GIPR increases insulin secretion in hyperglycemia and stimulates glucagon release in hypoglycemia. It also plays an important role in adipogenesis, islet β cell proliferation and insulin release, and is associated with type 2 diabetes, obesity and neurodegenerative diseases.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy