SKU: 5828477560

Mouse CD137, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse CD137, His tagProduct Specification Species Mouse Synonyms 4 1BB ligand receptor, T cell antigen 4 1BB, Tnfrsf9, Ila, Ly63 Accession P20334 Amino Acid Sequence Protein sequence (P20334, Val24 Leu187, with C 10*His) VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVLGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 19. 2 kDa Observed

Product Specification


Species Mouse
Synonyms 4-1BB ligand receptor, T-cell antigen 4-1BB, Tnfrsf9, Ila, Ly63
Accession P20334
Amino Acid Sequence

Protein sequence (P20334, Val24-Leu187, with C-10*His) VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVLGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 19.2 kDa Observed MW: 28, 32 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

CD137, a member of the tumor necrosis factor (TNF) receptor family, is a type 1 transmembrane protein, expressed on surfaces of leukocytes and non-immune cells.[1] Its alternative names are tumor necrosis factor receptor superfamily member 9 (TNFRSF9), 4-1BB, and induced by lymphocyte activation (ILA). It is of interest to immunologists as a co-stimulatory immune checkpoint molecule, and as a potential target in cancer immunotherapy.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 5828477560

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Cheryl J
Draper, US
★★★★★ 5
Great story, beautiful pics
Format: Board book
Perfect book to go into a baby shower gift basket. Nice pictures and love the board book
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026
S
Verified Purchase
Shanise
Port Orchard, US
★★★★★ 5
Good quality book
Format: Board book
I wanted a book that can be a keep sake for my baby. This one is, it is well made and of good quality. I love the little story I read it to my newborn everyday. I love how calm the drawing and even the colors in this book are makes the images less overestimating.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 5, 2026
L
Verified Purchase
Lady B
West Palm Beach, US
★★★★★ 5
The Illustrations are Sweet, Storyline… Great!
Format: Board book
This book is sturdy and has a wonderful message. My grandchildren love it! If you are the one who presents 2 children in a classroom or other setting, most children will really love this book. The durability of the book is great. The illustrations are sweet. The review platform does not allow for me to enter an age span. It does not allow for me to enter multiple ages. It seems to force you to Select one age. I would say that having raised children of my own, I would start reading this book by one years old, but the average child I guess would best benefit with between ages like two and four. The book could be read up to people who are like six years old if they just love a sweet bedtime story.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026
V
Verified Purchase
Vickie D. Roderick
Houston, US
★★★★★ 5
Ms V
Format: Board book
Awesome book for my nephew. The book is good for a new reader to learn words from.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
G
Verified Purchase
Gin
Pawtucket, US
★★★★★ 5
Great quality
Format: Board book
Sweet little book . Color is vibrant and quality is extremely nice.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026

recommand products