SKU: 57609366624

Human CBP, His tag

Sale price$144.00 Regular price$160.00
Save 10%

Pay in installments of $40.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 23 - Aug 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CBP, His tagProduct Specification Species Human Synonyms CREB binding protein, Histone lysine acetyltransferase CREBBP, Protein lysine acetyltransferase CREBBP, CREBBP, CBP Accession Q92793 Amino Acid Sequence Protein sequence (Q92793, Thr144 Ser417, with C 10*His)

Product Specification


Species Human
Synonyms CREB-binding protein, Histone lysine acetyltransferase CREBBP, Protein-lysine acetyltransferase CREBBP, CREBBP, CBP
Accession Q92793
Amino Acid Sequence

Protein sequence (Q92793, Thr144-Ser417, with C-10*His) TPAASQALNPQAQKQVGLATSSPATSQTGPGICMNANFNQTHPGLLNSNSGHSLINQASQGQAQVMNGSLGAAGRGRGAGMPYPTPAMQGASSSVLAETLTQVSPQMTGHAGLNTAQAGGMAKMGITGNTSPFGQPFSQAGGQPMGATGVNPQLASKQSMVNSLPTFPTDIKNTSVTNVPNMSQMQTSVGIVPTQAIATGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 29.9 kDa Observed MW: 43-90 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CREB-binding protein, also known as CREBBP or CBP or KAT3A, is a coactivator encoded by the CREBBP gene in humans. CBP has intrinsic acetyltransferase functions; it is able to add acetyl groups to both transcription factors as well as histone lysines, the latter of which has been shown to alter chromatin structure making genes more accessible for transcription. CBP alone has been implicated in a wide variety of pathophysiologies including colorectal cancer as well as head and neck squamous cell carcinoma. In these diseases, association of CBP with β-catenin has been shown to promote cancer cell proliferation and disease aggressiveness, whereas p300/ β-catenin leads to cell differentiation and/ or apoptosis. CBP has also been shown to help modulate liver function via maintenance of energy homeostasis in response to changes in cell nutrition conditions by regulating the activity of transcription factors and genes responsible for lipogenesis and gluconeogenesis. CBP is also implicated in the etiologies of several other diseases including hematologic malignancies and other solid tumors, diabetes, schizophrenia, Alzheimer's disease, depression, and many other neurological conditions.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 57609366624

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Grantham, US
★★★★★ 5
The Berkley Flex
Size: 7, Color: Cognac Multi
Very nice shoes, very comfortable, very nice leather. When ordering though, they fit a half size smaller than your size, because they are a tight-fitting shoe.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 25, 2025
M
Verified Purchase
Melissa S.
Los Angeles, US
★★★★★ 5
Better quality than most women’s shoes
Size: 7, Color: Black
I’m a woman and bought these for style and comfort after trying on too many others of multiple price points. These fit well and conformed to my feet after a single wear. Men’s clothes and shoes are so often of better quality.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 27, 2026
B
Verified Purchase
Bruce
New York, US
★★★★★ 4
Well made shoes.
Size: 11.5, Color: Black
Four stars because of the weight. Too heavy for my complete comfort. Also I have a narrow foot (C width) and these are too wide for me. Heavy socks make them wearable but not as comfortable as I would have liked.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 1, 2025
M
Verified Purchase
marsha
Phoenix, US
★★★★★ 5
Good look
Size: 11, Color: Brown Crazy Horse
Great look.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2026
D
Verified Purchase
Dave M
Phoenix, US
★★★★★ 1
Something's changed at Florsheim
Size: 11.5 Wide, Color: Black
I have a pair of size 11W Florsheim Palermo loafers that have lasted over 8 years and are still soft and exceptionally comfortable. Ordered a pair of 11W Florsheim Milano on Amazon but they are too small and have a cheap plastic sole. So, ordered 11.5W Florsheim Berkley and they were way too big. Returned them and ordered 11W Berkley instead and they were also too big ... and the Berkley also has a rubber sole instead of the original leather shown in the product photos. Guess they just don't make them like they used to.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026

recommand products