SKU: 54325598075

FABP6 His Tag, Human

Sale price$193.50 Regular price$215.00
Save 10%

Pay in installments of $53.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 25 - Aug 30

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FABP6 His Tag, HumanProduct Specification Species Human Synonyms ILeal Lipid binding protein Accession P51161 Amino Acid Sequence Met1 Ala128, with N terminal 8*His MHHHHHHHHMAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA Expression System E. coli Molecular Weight 16kDa (Reducing) Purity 95% by SDS PAGE & RP HPLC Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance

Product Specification


Species Human
Synonyms ILeal Lipid-binding protein
Accession P51161
Amino Acid Sequence Met1-Ala128, with N-terminal 8*His MHHHHHHHHMAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA
Expression System E.coli
Molecular Weight 16kDa (Reducing)
Purity

>95% by SDS-PAGE & RP-HPLC

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

FABP6(ILeal Lipid-binding protein, ILBP) is a cytoplasm protein which belongs to the calycin superfamily and Fatty-acid binding protein (FABP) family. It binds mainly to bile acids that are reabsorbed in the ileum. Thus, mice lacking FABP6 do not exhibit a fatty acid metabolic phenotype but are protected against gallstone disease. FABP6 is a cancer-related protein that acts as an intracellular transporter of bile acid in the ileal epithelium. FABP6 may also play an important role in early carcinogenesis.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 54325598075

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 19 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
P
Verified Purchase
patrick cadenhead
San Leandro, US
★★★★★ 2
Doesn’t work properly
The mount part was great, but I couldn’t get the charger to work. Had it replaced and it still didn’t work. Disappointing because otherwise it was great. I still use it as a mount and use a cord to charge.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2026
R
Ron
Grantham, US
★★★★★ 5
An amazing charger for the car that is super fast with just contact
This wireless charger mount charges much faster than my old wireless charger and now helps me keep my phone charged throughout the day just from my commute. The mount works well in my Ford Lightning display which is similar to the Tesla as well. The ability to charge at 25W really makes it faster than even plugging it in directly with a cable. This is very helpful for quick access and making sure it is always charging. The magnet is quite strong and I have no concerns of the phone falling off at all. The maneuverability of the mount is quite robust and allows the phone to sit at whatever angle you want it to. You can adjust to the side of the monitor, all the way to the top as well with articulation for fine tuning the angle on the z axis. The phone charges about 15-20% during my 15 minute commute which is huge to keep the charge up before and after work.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026
J
Jon V
Lexington, US
★★★★★ 4
Super helfpul in the summer
Pros: Charging functionality supports fast wireless output. Mount design integrates cleanly with dashboard appearance. Cooling fan improves charging durability. Works well with MagSafe alignment. RGB lighting enhances visual look. Strong suction Easy to adjust to fit and manoeuvre Cons: Noise level from fan audible. Installation alignment requires precision. Lighting brightness distracting at night. Value for money higher than basic mounts.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 18, 2026
J
Jennifer Renee Shipman
Alexandria, US
★★★★★ 5
Coolest wireless charger design I've seen
I just gotta say that this is the coolest design for a wireless charger, looks kinda futuristic. Now how well does this work? Amazingly well and truly easy to use. It is adjustable, stable and much safer for everyone. I really like this charger.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2026
G
Gus A.
Phoenix, US
★★★★★ 3
Wow that light color ring is annoying
There is no way to turn this color light off. I don't even know why it has to have a light at all. I suppose it is to tell you it has power. But the light could have been something that momentarily turns on and then off as you place the phone on. I'm a DIY'er and I'm going to find a way to take this apart and disable the light. I'll report back if I'm successful. The good news is that this mount is identical to another one I have except for the magnet charging section. I'm talking it is identical down to the knobs and metal arm so it's generic in that sense. They only changed out the magnetic section. This type of mount holds well to the screen. The charging speed seemed adequate. Not terribly fast but not slow. Wirelessly charging is always slower than plugged in. The supplied USB cable is braided and feels like quality. See attached picture. This mount is not something you'll necessarily want to use every time you drive. Therefore the color ring is annoying.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 20, 2026

recommand products