SKU: 52230077947

Human IL-6

Sale price$180.00 Regular price$200.00
Save 10%

Pay in installments of $50.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 22 - Aug 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-6Product Specification Species Human Synonyms Interleukin 6, B cell stimulatory factor 2 (BSF 2), CTL differentiation factor (CDF), Hybridoma growth factor, Interferon beta 2 (IFN beta 2), IL6, IFNB2 Accession P05231 Amino Acid Sequence Protein sequence (P05231, Val30 Met212)

Product Specification


Species Human
Synonyms Interleukin-6, B-cell stimulatory factor 2 (BSF-2), CTL differentiation factor (CDF), Hybridoma growth factor, Interferon beta-2 (IFN-beta-2), IL6, IFNB2
Accession P05231
Amino Acid Sequence

Protein sequence (P05231, Val30-Met212) VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Expression System HEK293
Molecular Weight

Predicted MW: 20.8 kDa Observed MW: 20, 21 kDa

Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Interleukin 6 (IL-6) is an interleukin that acts as both a pro-inflammatory cytokine and an anti-inflammatory myokine. Osteoblasts secrete IL-6 to stimulate osteoclast formation. Smooth muscle cells in the tunica media of many blood vessels also produce IL-6 as a pro-inflammatory cytokine. IL-6's role as an anti-inflammatory myokine is mediated through its inhibitory effects on TNF-alpha and IL-1 and its activation of IL-1ra and IL-10. There is some early evidence that IL-6 can be used as an inflammatory marker for severe COVID-19 infection with poor prognosis, in the context of the wider coronavirus pandemic. IL-6 stimulates the inflammatory and auto-immune processes in many diseases such as multiple sclerosis, neuromyelitis optica spectrum disorder (NMOSD), diabetes, atherosclerosis, depression, Alzheimer's disease, systemic lupus erythematosus, multiple myeloma, prostate cancer, Behçet's disease, rheumatoid arthritis, and intracerebral hemorrhage.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 52230077947

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 21 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amy Sarah
Louisville, US
★★★★★ 5
Shear and effective. Excellent!
Size: 3 Fl Oz (Pack of 2), Style: SPF 30
Shear, effective. Excellent.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026
C
Verified Purchase
Curly and Cruelty Free
Lexington, US
★★★★★ 4
TSA approved but…
Size: 3 Fl Oz (Pack of 2), Style: SPF 30
I’m not super picky when it comes to sunscreen and I needed a sunscreen that would be TSA approved. This fit the bill and didn’t break the bank (getting a 2 pack is nice as well). However, I find that this sunscreen just underperformed for me. It could be that I should up the SPF factor but when using my usual brand their 30 works a bit better than Banana Boat’s version. I wouldn’t say that this product is useless because it did prevent burning in certain areas but I still burned a bit in other areas. However, this could be my fault. I was outside for about an hour with 9 UV rays in a bikini in the California sun. I will say that I did reapply before 2 hrs so I’m just a little bit let down that it didn’t quite perform a bit better. But again, could be user error and perhaps just be really particular about your application technique. If you’re in a pinch, go for it but I’d honestly even recommend upping your SPF factor if you are set on Banana Boat’s while still meeting the TSA sizing requirement. Smells good though and isn’t the stickiest compared to some of the other brands!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 11, 2025
D
Verified Purchase
Dennis King
Charlottesville, US
★★★★★ 5
Works well
Size: 3 Fl Oz (Pack of 2), Style: SPF 30
Good product
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2026
C
Verified Purchase
Chris
Natrona Heights, US
★★★★★ 5
Good sunblock. New bottle design with easy to read expiration date.
Size: 8 Fl Oz (Pack of 1), Style: SPF 30
When reviewing this product. It ask you to put a STAR for: Sun protection Water resistance I put 5 stars because, how would i know? I don't use it to go into water and you'd need to be a scientist testing how good the sun protection is. I just assume it works. But i've used banana boat sunblock in the past. And it's been fine. No sunburns. As long as you remember to re-apply it because it's not meant to last all day. Pros: - It's sunblock - It works (from my previous experience) - New bottle design. They changed the style of the bottle. The new bottle has the date on it. The old bottles only had a serial number. In order to find out if your old bottles are expired you had to go to the banana boat website and see the instructions on how to read the serial # that way you can know the expiration date. The new bottle is more simple, the date is laid out easy to read on the bottle. - Long expiration date: I bought this sunblock around april or may of 2020 and the bottle says it will expire January 01, 2022 - Nice slim bottle to fit into a small bag. Cons: - It's a small 8 FL OZ bottle. My old bottle is a 10 FL OZ. Not sure if they still sell the 10FL OZ. - It feels a little heavy and thick on the skin. But after a while it's fine. - If you rub your hands / fingers around your eye, especially if you're sweaty. You might get the sunblock into your eyes. That has happened to me on hot summer days. It will make you teary eyed and irritate your eyes for a long while. - I hear this sunblock may stain clothes. So far that has not happened to me.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2020
L
Verified Purchase
Laramie
Fort Morgan, US
★★★★★ 5
Ideal Sunscreen for Backpacking Adventures!
Size: 3 Fl Oz (Pack of 2), Style: SPF 30
I recently used Banana Boat Sport Ultra Sunscreen Lotion SPF 30 on a backpacking trip, and it was absolutely perfect for my needs. This sunscreen provided excellent protection and convenience, making it a standout choice for outdoor activities. First off, the SPF 30 rating offers reliable protection against harmful UV rays, which is crucial for long hours spent in the sun. The lotion goes on smoothly and absorbs quickly without leaving a greasy residue, which is a huge plus when you’re on the move. The size of the bottle is spot-on for backpacking. It’s compact and lightweight, fitting easily into my gear without taking up too much space. This makes it convenient to carry and apply whenever needed, ensuring that I stay protected without adding bulk to my pack. The water-resistant formula held up well even during sweaty hikes and water crossings. I didn’t have to reapply excessively, and it stayed effective throughout the day. The lotion also has a pleasant, non-overpowering scent, which is a nice bonus. In summary, Banana Boat Sport Ultra Sunscreen Lotion SPF 30 is an excellent choice for anyone heading into the great outdoors. Its effective sun protection, ideal size for backpacking, and water-resistant properties make it a must-have for any adventure. Highly recommended for keeping your skin safe and comfortable while exploring!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 7, 2024

recommand products