SKU: 48205645754

Rhesus macaque TNFSF15 Protein, His Tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 25 - Aug 30

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Rhesus macaque TNFSF15 Protein, His TagProduct Specification Species Rhesus macaque Synonyms Tumor necrosis factor ligand superfamily member 15, TNF ligand related molecule 1, Vascular endothelial cell growth inhibitor, TNLG1B Accession F6S8F9 Amino Acid Sequence Protein sequence (F6S8F9, Leu72 Leu251, with N His Tag)

Product Specification


Species Rhesus macaque
Synonyms Tumor necrosis factor ligand superfamily member 15, TNF ligand-related molecule 1, Vascular endothelial cell growth inhibitor, TNLG1B
Accession F6S8F9
Amino Acid Sequence

Protein sequence (F6S8F9, Leu72-Leu251, with N-His Tag) LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHLKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFVYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Expression System HEK293
Molecular Weight Predicted MW: 22.1 kDa Observed MW: 25-30 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

TNFSF15 (Tumor Necrosis Factor Superfamily Member 15), also known as TL1A, is a cytokine that binds to death receptor 3 (DR3) and decoy receptor 3 (DcR3). It plays a key role in modulating immune responses, particularly in T-cell activation, inflammation, and autoimmune diseases. TNFSF15 is highly expressed in endothelial cells and contributes to angiogenesis and vascular remodeling. Dysregulation of TNFSF15 is linked to inflammatory disorders (e.g., Crohn’s disease, rheumatoid arthritis) and cancers. Its dual role in pro-inflammatory and anti-angiogenic signaling makes it a potential therapeutic target for immune-mediated and vascular diseases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 48205645754

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
R. J. McCabe
Whiting, US
★★★★★ 3
Please use a larger font
Format: Hardcover
Over 60 and sometimes have a difficult time with too small print? My advise .. either read it on an ebook or skip this one. I read the first chapter despite the small font size that made it a little too difficult to read. While I found it informative and well worth reading I'm probably not going to read anymore and return it to the library. Mass market paperback books with small print I can understand. Hardback non-fiction books (which are generally read by an older crowd I suspect) make no sense to me. 5 stars for the content I read. 1 star (generously) for the font size.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 6, 2020
G
Verified Purchase
GWG
Waukegan, US
★★★★★ 5
Great review and analysis of a law that underpins the Internet
Format: Kindle
This book provides a detailed history of how section 230 if the Communications Decency Act came to be, its importance and its problems as the industry of the Internet matures. While it is ultimately a defense of that law, it is an eyes wide open look at it as well. It is not a prophet's telling of what to do, but instead an informative read that gives the reader an ability to assess what might be done to address the issues 230 raises.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 9, 2019
M
Verified Purchase
mark grabe
Grantham, US
★★★★★ 5
Dealing with complexity
Format: Kindle
Section 230 is a simple effort to govern what must be the innovation of our time. This account is a great effort to explain the accomplishments and challenges that simple can allow.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 27, 2022
M
Verified Purchase
Maria A Nieves
Lowell, US
★★★★★ 5
Five Stars
Great and fast transaction
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2016
B
Verified Purchase
Blanch Cur Vie
Dallas, US
★★★★★ 4
Good reference text
Format: Paperback
Great introduction for anyone new to the P&C industry. Good reference as well for the more well-seasoned readers.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 19, 2010

recommand products