SKU: 47438163423

Human IL-19, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-19, His tagProduct Specification Species Human Synonyms Melanoma differentiation associated protein like protein, NG. 1, ZMDA1 Accession Q9UHD0 Amino Acid Sequence Protein sequence(Q9UHD0, Leu25 Ala177, with C 10*His) LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSAGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 19. 5kDa Actual: 29kDa

Product Specification


Species Human
Synonyms Melanoma differentiation-associated protein-like protein, NG.1, ZMDA1
Accession Q9UHD0
Amino Acid Sequence

Protein sequence(Q9UHD0, Leu25-Ala177, with C-10*His)
LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSAGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 19.5kDa Actual: 29kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

Interleukin 19 (IL-19) is an immunosuppressive protein that belongs to the IL-10 cytokine subfamily. The IL-19 protein is composed of 159 amino acids and has a quaternary structure with alpha helix motifs and loops. IL-19 is preferentially expressed in monocytes, macrophages, and T and B lymphocytes, but interacts with immune cells (macrophages, T cells, B cells) and non-immune cells (endothelial cells and brain resident glial cells, etc). IL-19 is associated with broad functions across inflammation, cell development, viral responses, and lipid metabolism. As an immunosuppressive cytokine, IL-19 promotes the Th2 (regulatory) T-cell response which supports an anti-inflammatory lymphocyte phenotype, dampens the Th1 T-cell response and inflammatory cytokine secretion (IFNγ), increases IL-10 (anti-inflammatory) expression in peripheral blood mononuclear cells (PBMC), and inhibits the production of immunoglobulin G (IgG) from B cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 47438163423

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Dimairy
Omaha, US
★★★★★ 5
So soft and pretty!
Size: 2' x 6' (Sheepskin), Color: White
Really happy with this rug! It’s super soft and looks amazing in my space. The color is perfect and goes with everything. Great quality for the price. Definitely recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026
J
Verified Purchase
JENNIFER
Lake Worth, US
★★★★★ 5
Excellent Rug & Unbeatable Customer Service!
Size: 6 x 8 ft Rectangle, Color: White
I absolutely love this rug! It has completely transformed my living room—it looks surprisingly glam and feels wonderfully soft underfoot. The feature that really sold me was that it's fully washable. I was nervous about cleaning it, but the process was surprisingly easy. I strongly recommend skipping the dryer and letting it air dry. I simply hung mine over my shower door, and it was completely dry overnight. I used a brush to gently separate the fibers, leaving it looking just as vibrant and feeling just as soft as it did when new. Additionally, I had an interaction with their customer support team, and they were fantastic. They responded to my inquiry quickly, were respectful, and resolved my issue completely and professionally. I highly recommend this product for anyone looking for a beautiful, practical, and soft rug with stellar customer service backing it up. Five stars!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 25, 2025
T
Verified Purchase
TheSuite1
Fort Morgan, US
★★★★★ 4
Soft but no cushion
Size: 2' x 8' (Runner), Color: White
This rug is nice and soft but too thin for me. It’s very beautiful, it’s soft and fluffy but not enough cushion for my taste
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 28, 2026
B
Verified Purchase
Brightin Browning
Carnegie, US
★★★★★ 5
SOFT, SILKY,Like Butter
Size: 3' (Round), Color: Light Yellow
This rug is the perfect size for the side of my bed. It is so soft, and the lightest, prettiest yellow.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2026
K
Verified Purchase
Kyle Taylor
Grantham, US
★★★★★ 3
Cool rug, but sheds like an animal.
Size: 5' x 8' (Rectangular), Color: White With Grey Tips
It's beautiful and comfy, but it sheds like a dog, so I had to get rid of it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 12, 2026

recommand products