SKU: 45357149263

DDB1/CRBN Complex, Flag&His Tag, Human

Sale price$162.00 Regular price$180.00
Save 10%

Pay in installments of $45.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 19 - Sep 24

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

DDB1/CRBN Complex, Flag&His Tag, HumanProduct Specification Species Human Synonyms DDB1 CRBN Complex Accession Q16531Q96SW2 Amino Acid Sequence DDB1 Flag Tag, Human Met1 His1140

Product Specification


Species Human
Synonyms DDB1/CRBN Complex
Accession Q16531、Q96SW2
Amino Acid Sequence

DDB1 Flag Tag, Human
Met1-His1140
DYKDDDDKMSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPGIKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELR
TECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH
CRBN His Tag, Human
Met1-Leu442
HHHHHHHHGGGSGGGSMAGEGDQQDAAHNMGNHLPLLPAESEEEDEMEVEDQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVLPQVMMILIPGQTLPLQLFHPQEVSMVRNLIQKDRTFAVLAYSNVQEREAQFGTTAEIYAYREEQDFGIEIVKVKAIGRQRFKVLELRTQSDGIQQA
KVQILPECVLPSTMSAVQLESLNKCQIFPSKPVSREDQCSYKWWQKYQKRKFHCANLTSWPRWLYSLYDAETLMDRIKKQLREWDENLKDDSLPSNPIDFSYRVAACLPIDDVLRIQLLKIGSAIQRLRCELDIMNKCTSLCCKQCQETEITTKNEIFSLSLCGPMAAYVNPHGYVHETLTVYKACNLNLIGRPSTEHSWFPGYAWTVAQCKICASHIGWKFTATKKDMSPQKFWGLTRSALLPTIPDTEDEISPDKVILCL

Expression System Baculovirus-InsectCells
Molecular Weight

128&53kDa (Reducing)

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tags & Cleavage sites Flag Tag; His Tag
Physical Appearance Liquid
Storage Buffer 20mM Tris,300mM NaCl,10%Glycerol,1mM DTT, pH7.5.
Stability & Storage

·12 months from date of receipt, -20 to -70 °C as supplied.
·1 month, 2 to 8 °C under sterile conditions after reconstitution.
·Please avoid repeated freeze-thaw cycles.

Reference

Fischer E.S.,et al. (2014) Nature 512: 49
He Y.J., et al. (2006) Genes Dev. 20: 2949
Ito T., et al. (2010) Science 327: 1345
Wang H., et al. (2006) Mol. Cell 22: 383

Background

Cereblon (CRBN) is the substrate recognition component of DCX (DDB1-CUL4-X-box) E3 Ubiquitin ligase complexes that mediate the ubiquitination of numerous target proteins including the transcriptional regulator MEIS2. CRBN plays an important role in limb outgrowth, and its function in this process is perturbed by the binding of thalidomide and related compounds. Binding of CRBN to Cullin-4 is mediated in part by DNA damage-binding protein 1 (DDB1), a component of multiple DCX class ligases. In addition to its role in limb development, DDB1 is also involved in various DNA damage response mechanisms. This product consists of an untagged complex of DDB1 and CRBN.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 45357149263

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
S T
Lexington, US
★★★★★ 4
Fudge!
Format: Kindle
Titles aren’t my strong suit. Sorry not sorry. That ending has me completely frustrated book two isn’t out yet. Just throwing that out there. First thing first, this is a high school book where the lead is under 18. Yea yea she’s about month from being an adult, but I can’t say I would’ve even opened the file if I’d realized. It’s not a smut fest or anything, but there is sexual tension as each party figures out their emotions. That being said, it’s a good book. There are some troubling parts, like how the supes come into their powers at 13, but most of those are dealt with in a way that makes sense. Kian is the exception. His whole arc pisses me off, especially since no one stepped in. Reflecting back on real world situations, ten or so years ago, I can see it happening, but it still makes me sick. Which, I’m sure was the whole damn point. For the most part, Courting Darkness is a fun read. I found myself laughing along with most of the set up. By the time it started getting serious, I’d grown to like the characters enough it held an impact. I’ll be adding book two to my list for when it comes out.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 8, 2022
D
Verified Purchase
Dee
Belleville, US
★★★★★ 5
Intriguing
Format: Kindle
An intriguing story that played out slowly while introducing some unique characters. The story became quite fascinating to read as these same characters provided startling revelations to their lives. As their relationships evolve, more drama and mystery is revealed adding to my fascination. I can’t wait to read more.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
D
Verified Purchase
Darcy Smith
Lake Worth, US
★★★★★ 5
Outstanding Story!!!!!!!
Format: Kindle
Oh I loved this story. Sera is such an amazing, fun character. She has so much fire inside of herself. She has humor that makes you laugh with her sassy comments. The guys are fantastic. I don’t feel as if we really have gotten to know who and what they are but they are such a mix of fae. The story is extremely well written and developed. It had me pulled in and didn’t let go. There was so much action, drama, and suspense. Then we get to the ending and goodness there is so much going on. This ending was a major cliffhanger and I absolutely can’t wait to see what happens next.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 12, 2024
K
Verified Purchase
Kathleen G. Bohle
Lexington, US
★★★★★ 5
Exceptional
Format: Kindle
I think this an exciting entertaining story different from other fantasy reverse harmen story. I love the 1st book in this series and hope it continues to weave a story of friendship, love and disappointment as well as sadness. The cliffhanger was gripping and held you in suspense that waiting until the next book was released was almost too much. I’m so glad I waited to read this series until the majority of the books were released. Katie May and Quinn Arthur’s are wonderful writers and I’m looking forward to reading more from both of them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2025
J
Verified Purchase
Johanna J
Pawtucket, US
★★★★★ 3
I don’t mind a cliffhanger,
Format: Kindle
but I dropped at least one star because of the obnoxious gloating of the author after the cliffhanger. Seriously - I don’t understand making your readers angry because you’re smug and expecting them to keep reading your books. I was very definitely enjoying the series. Now I have a bad taste in my mouth and mixed feelings about continuing the series.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 9, 2025

recommand products