SKU: 41965322815

AAK1 Protein

Sale price$345.15 Regular price$383.50
Save 10%

Pay in installments of $95.88 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

AAK1 ProteinProduct Specification Species Human Synonyms AAK1AP2 associated protein kinase 1 Accession Q2M2I8 1 Amino Acid Sequence T27 A365

Product Specification


Species Human
Synonyms AAK1,AP2-associated protein kinase 1
Accession Q2M2I8-1
Amino Acid Sequence

T27-A365

TSGLGSGYIGRVFGIGRQQVTVDEVLAEGGFAIVFLVRTSNGMKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVSSGDVWEVLILMDFCRGGQVVNLMNQRLQTGFTENEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKFQNPQTEGVNAVEDEIKKYTTLSYRAPEMVNLYSGKIITTKADIWALGCLLYKLCYFTLPFGESQVAICDGNFTIPDNSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLLKKECPIPNVQNSPIPAKLPEPVKASEAAAKKTQPKARLTDPIPTTETSIA

Expression System Baculovirus-InsectCells
Molecular Weight 40.2 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Liquid
Storage Buffer 20mM Tris, 300mM Nacl, 1mM DTT, pH8.0
Stability & Storage

-80℃

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 41965322815

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kristen L. Mitchell
Waukegan, US
★★★★★ 5
GREAT Suction!! Looks fantastic!
Color: Silver, Color: Silver
I wanted to find a sponge holder with great suction for our ceramic sink. This is the REAL DEAL! I saw one or two complaints on the reviews below but obviously they are doing something wrong, because if you just follow the instructions (make sure the sink is clean and dry where you stick it), it works perfectly. I've had it for about 3 weeks now and we use it every single day and it has never slipped even once. The suction cups are big and made of good plastic so they really do the job. It hasn't budged from the spot where I placed it. It's also easy to take the caddy off of the suction cups when you want to clean the sink without moving the suction cups. You can peel them off easily and reposition them but they will not move unless you want them too. It's also the perfect size and looks great. Perfect for holding a stick sponge upright so that the soap doesn't leak out of it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 14, 2020
S
Verified Purchase
SonicHog
West Palm Beach, US
★★★★★ 4
Great product. Suction can be improved though.
Color: Silver
I'm satisfied with my purchase. It gets the job done. The suction pads can definitely be improved though, I found that pads couldn't keep the holder in place for more than an hour so I just removed the suction pads and kept it beside my sink. Overall, great product. Would definitely recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 13, 2020
T
Verified Purchase
Timothy Jeandrevin
Lowell, US
★★★★★ 5
It actually sticks to the sink and stays where it is supposed to. Well made. We love it!
Color: Silver
Finely, a sink caddy that actually sticks to the sink! We have been so frustrated trying to find one that does. This one is great. We just used the suction cups, which are large and there are 3 of them. If finely actually stays there!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 13, 2026
B
Verified Purchase
Beth
Birmingham, US
★★★★★ 5
Works & Looks Great!
This item comes with two options for sticking to the sink, suction cups & an adhesive thing. I decided to try the suction cups first, that way I can remove them to clean, plus I wanted to test out the position of where I put it on the sink. They work great! I haven’t had to re-stick not once. Great staying power! And it looks really good! Also, the seller sent a follow-up message just to check in & offer answers if any questions arose. That meant the world to me, like it’s not every day a seller cares what you think once money changes hands. 10/10 would recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2024
E
Verified Purchase
Efren
Chelsea, US
★★★★★ 5
Small size, but holds up to two sponges
Needed something to hold my sponges in the sink and this did the job
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026

recommand products