Pay in installments of $56.25 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 25 - Aug 30
For Your Every Summer RSVP, with Code: SUMMER15
Description
FABP8 His Tag Protein, HumanProduct Specification Species Human Synonyms Fatty acid binding protein 8, P2, PMP2 Accession P02689 Amino Acid Sequence Ser2 Val132, with N terminal 8*His MHHHHHHHHSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV Expression System E. coli Molecular Weight 18kDa (Reducing) Purity 95% by SDS PAGE & RP HPLC Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical
Product Specification
| Species | Human |
| Synonyms | Fatty acid binding protein 8, P2, PMP2 |
| Accession | P02689 |
| Amino Acid Sequence | Ser2-Val132, with N-terminal 8*His MHHHHHHHHSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV |
| Expression System | E.coli |
| Molecular Weight | 18kDa (Reducing) |
| Purity | >95% by SDS-PAGE & RP-HPLC |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 20mM Tris, 100mM NaCl, pH8.0 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
FABP8 (fatty acid binding protein-8; also M [myelin]-FABP, P2 and PMP2) is also known as peripheral myelin protein 2, which is a cytosolic protein found primarily in peripheral nerves. PMP2 is a small, basic, and cytoplasmic lipid binding protein of peripheral myelin. Also, PMP2 may play a role in lipid transport protein in Schwann cells. Furthermore, PMP2 may bind cholesterol. PMP2 is a small, basic, and cytoplasmic lipid binding protein of peripheral myelin, which is a cytosolic protein found primarily in peripheral nerves.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.3 ★★★★★
Based on 5 reviews
Sort
Product Reviews
★★★★★ 5
Worth every penny
So far so good better than the plain cabin air filter , last longer and price is right so it’s a win win for me
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2026
★★★★★ 4
Did not fit my car
Style: HCC1817-X
The product looks good and does fit a 2024 Hyundai Tucson hybrid.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 12, 2026
★★★★★ 5
Health, Eco, AND Econo friendly.
Style: HCC2128-X
40K+ miles o my 2020 Ranger. Thought I’d replace the CAF (cabin air filter.) Holy c__p. The original factory filter was clogged with dust, mesquite seeds, Palo verde droppings -YUCK. This reusable filter improved airflow immensely, plus the cabin feels fresher. Quite a bargain compared to the major brand reusable CAF (K_N) too, or pulling clogged filters, throwing them in the trash and buying a new disposable filter to install. I’m looking forward to pulling this in a month and seeing what it kept out of my breath, washing it, and reinstalling it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 23, 2025
★★★★★ 5
Great filter
Style: HCC2146-X
My husband said this filter was high-quality, he was quite impressed. We’re not crazy about the washable kind normally, so we’ll have to see how it holds up.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 29, 2026
★★★★★ 5
Filter Fits Properly and is an Easy Install
Style: Particulate Media
Though not made for or by Honda, this filter is inexpensive and looks like it's capable of filtering the air coming into the passenger compartment of our 2012 Honda Fit. The primary difference between this unit and the original filter supplied by Honda is that the original unit has some "ribs" that help to keep the pleats separated attached to the top of the pleats. The item I received lacks that, but it appears to me that the pleats are strong enough on their own for the intended purpose. The filter fits into the frame as it should. Replacing this filter is incredibly easy and requires no tools: you empty the glove compartment, compress it's sides inward so that the rubber stops on either side clear the dash, allowing the glove compartment to drop out an extra 4-5 inches. Then, you can see and reach the cover for the cabin air filter, which is secured by latches on each side. Remove the cover and slide out the filter and frame. Replace the air filter element, which just sits in the frame, replace the frame and cover, and compress the glove compartment sides again to put it back in place. Put your stuff back in the glove compartment and you're done. In a few minutes you've saved significant dollars over the cost of having this done in the shop. Congratulations! The engine air filter is equally easy to replace in the Fit, though for that job I prefer to use a Honda OEM part.
Edit: I thought I should add a reminder to install the filter in such a way that the air flow indicator is the same as the one that you remove, i.e. do not put it in upside down. If I remember correctly, air flows from above to below in the Honda Fit. Also, currently, the price for this item is not competitive.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 21, 2014