SKU: 40721854098

TNF-α Protein, Mouse

Sale price$144.00 Regular price$160.00
Save 10%

Pay in installments of $40.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

TNF-α Protein, MouseProduct Specification Species Mouse Synonyms TNF , Cachectin, Tumor Necrosis Factor Alpha, TNFSF1A Accession P06804 Amino Acid Sequence Leu80 Leu235, with N terminal 6*His MHHHHHHLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL Expression System E. coli Molecular Weight 18. 2kDa Purity >95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated

Product Specification


Species Mouse
Synonyms TNF-α, Cachectin, Tumor Necrosis Factor-Alpha, TNFSF1A
Accession P06804
Amino Acid Sequence

Leu80-Leu235, with N-terminal 6*His MHHHHHHLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL

Expression System E.coli
Molecular Weight

18.2kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris, 150mM NaCl, 2mM TCEP, pH8.0
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Pennica D. et al. (1984) Human tumour necrosis factor: precursor structure, expression and homology to lymphotoxin. Nature. 312(5996): 724-729.

2、Nedospasov S A. et al. (1986) Tandem arrangement of genes coding for tumor necrosis factor (TNF-alpha) and lymphotoxin (TNF-beta) in the human genome. Cold Spring Harb Symp Quant Biol. 51(1): 611-624.

Background

Tumor necrosis factor α (TNF alpha) is an effective pro-inflammatory cytokine, which can kill and inhibit tumor cells. It is mainly produced by activated macrophages and can also be secreted by other types of cells, such as CD4+ lymphocytes, NK cells, neutrophils, mast cells, eosinophils and neuronal tissues. The members of TNF alpha family exert their cellular effect through two distinct surface receptors of the TNF receptor family, TNFR1and TNFR2. The pleiotropic biological effects of TNF can be attributed to its ability to simultaneously activate multiple signaling pathways in cells. TNF-induced NF-κB activation promotes the growth, invasion and metastasis of cancer cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 40721854098

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 7 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jimbo
Boise, US
★★★★★ 5
Wiring harness not included!
Color: 26Inch Light White, Color: 26Inch Light White
Replaced my 19 inch Nilight after 6 years. This 26 inch fits perfectly and is bright af. Outstanding product. Doesn’t come with wiring harness, but my existing one worked great. Looks awesome!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 18, 2026
A
Verified Purchase
Al N.
Battle Creek, US
★★★★★ 5
Brighter than my headlights on bright!
Color: 26Inch Light White
This Nilight 26 inch 540 watt 50,000 lumen Triple Row Driving light is the brightest light I've ever had on my truck. I bought a kit to mount the light to my Grill Guard, just above the bumper. I can see deer just like daytime, at least two blocks before I get to them. I've never seen a light bar as bright. There are no cons if you ignore the fact that it comes without a wiring harness. I definitely recommend this light bar!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 9, 2026
Z
Verified Purchase
Zachary Russell
Natrona Heights, US
★★★★★ 5
Satisfied customer!
Color: 26Inch Light Amber&White w/Wiring Harness, Color: 26Inch Light Amber&White w/Wiring Harness
First, the picture isn't great, but I didn't intend it for the review. I'm really impressed with the quality and brightness of this light for the price! Installation was easy and straightforward. If you can do some basic work with hand tools, you can install this light in about 30 minutes, including wiring. I like the functionality of having the different light modes, although I typically just use the bright white setting. Some people complained about water getting into their light, but I haven't had any problem with water resistance after several months (including rain, snow, off-roading, and spraying it down with high pressure at the car wash. It fit perfect, just make sure you pay attention to the measurements before you order.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 14, 2025
A
Verified Purchase
Amazon Customer
Boise, US
★★★★★ 4
Great performance but low grade material.
Color: 26Inch light White +Wiring Harness, Color: 26Inch light White +Wiring Harness
I want to give it 5 stars but I can't because: The light bar is extremely bright and they go a great distance. I am very satisfied with how much it puts out. 5 out of 5 stars for its performance. HOWEVER nilight seems like they're starting to go cheap with their build material. 2 out of 5 stars for that. I have added photos of the older material vs new material for reference. Their old material is 3.3mm thickness compared to their new material at 2.7mm thickness. And that's for the mounting brackets and the light bar housing. It doesn't seem like .6mm would be a big deal but it's noticeably less rigid. Hand tight started bending the metal. Great product for sure but build material is low grade. Not trying to knock them, I love nilight products and will keep using them but it seems like they trying to save money by cutting weight which makes it less rigid. Dings and scratches come easily now. It worries me a little bit if it can take the abuse of vibrations over time from driving around now.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 19, 2026
R
Verified Purchase
Richard M
Pawtucket, US
★★★★★ 5
It will light up your life
Color: 26Inch Light White w/Wiring Harness
I only got to use them once before my jeep was totaled. They’re super bright. Great build quality. It survived taking a header down a mountain side and rolling 4 times. When the jeep was recovered, the light bar still worked!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 16, 2025

recommand products