SKU: 39699383268

Human TL1A/TNFSF15 Protein, His Tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 18 - Sep 23

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human TL1A/TNFSF15 Protein, His TagProduct Specification Species Human Synonyms Tumor necrosis factor ligand superfamily member 15, TNF ligand related molecule 1, Vascular endothelial cell growth inhibitor, TL1, VEGI Accession O95150 Amino Acid Sequence Protein sequence (O95150, Leu72 Leu251, with C His tag) LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Product Specification


Species Human
Synonyms Tumor necrosis factor ligand superfamily member 15, TNF ligand-related molecule 1, Vascular endothelial cell growth inhibitor, TL1, VEGI
Accession O95150
Amino Acid Sequence

Protein sequence (O95150, Leu72-Leu251, with C-His tag) LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Expression System HEK293
Molecular Weight Predicted MW: 22.2 kDa Observed MW: 22, 25, 28 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

TNFSF15 (Tumor Necrosis Factor Superfamily Member 15), also known as TL1A, is a cytokine that binds to death receptor 3 (DR3) and decoy receptor 3 (DcR3). It plays a key role in modulating immune responses, particularly in T-cell activation, inflammation, and autoimmune diseases. TNFSF15 is highly expressed in endothelial cells and contributes to angiogenesis and vascular remodeling. Dysregulation of TNFSF15 is linked to inflammatory disorders (e.g., Crohn’s disease, rheumatoid arthritis) and cancers. Its dual role in pro-inflammatory and anti-angiogenic signaling makes it a potential therapeutic target for immune-mediated and vascular diseases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 39699383268

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Joe Gonzalez
West Palm Beach, US
★★★★★ 5
It Does a Great Job!
Style: 51oz|Straight Styles
This brewer is great for cold brewing loose teas. Is glass and Stainless Steel, so no micro trash. The glass is very delicate so handling needs to be careful. Great product. I bought another one.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 16, 2026
A
Verified Purchase
Adam Rainier
Battle Creek, US
★★★★★ 5
Makes Fantastic Cold Brew. Thoughtful Design. Slightly Frail, But Approaches Perfection.
Style: 51oz|Conical Styles
When I looked for a dedicated cold brew pitcher, I had a few conditions. Mainly I wanted to avoid plastic at all costs. I needed a pitcher that would be easy to clean and simple to use, without pointless bells and whistles. Finally, I wanted a pitcher that could fit in my fridge without issue. This pitcher achieves all that and then some. Borosilicate is the same stuff Pyrex used to make its glassware from, a material renowned for its durability especially when exposed to quick temperature shifts. I knew it was overkill, but such material would surely fit the bill. And glass wouldn't affect the flavor of whatever coffee I'd brew in it. The grind holder is made from stainless steel, with a fine mesh that largely prevents sediment from getting into the coffee. It does allow smaller particles to get through, but they settle to the bottom. Overall I can't complain. The grind holder is suspended by a rubber ring which also locks the pitcher's lid in place. This forms a nice little seal that seems to help prevent leaking. Obviously there is no vacuum capability here, but it feels sturdy and like it won't let anything in or out once the grind holder is in. Pouring is easy and accurate. I remove the lid and grind holder, then pour. There's never any spillover nor dripping. The pitcher has a good, well-crafted pouring tip. Brewing with the pitcher takes a bit of practice. First I dump old grinds if necessary, then fill the grind holder roughly 3/4 of the way with cold brew grinds. BEFORE I place the grind holder into the pitcher, I fill the pitcher with water about 2 inches below the max line. After that, I place the grind filter into the pitcher then slowly press down on the grinds to flatten and wet them. Finally, I slowly pour water in to hit the max line, flattening the grounds as I do. While the pitcher has notches to determine how much liquid it holds, I don't find that feature helpful because I only use the pitcher with a grind holder which boosts the liquid. I imagine the notch lines may be more helpful for someone using this as a standard pitcher without the grind holder in place. I've accidentally overfilled this pitcher many times before deciding the best way, in my opinion, to handle it as described above. I've tried placing the grind holder in and then pouring all of the water over the grinds. But because grinds have a tendency to rise and overflow, that method proved messy and ineffective. This is why I add most of the water first, then only add a very small amount of water AFTER putting the grind holder into position just to top it off. So how good is the cold brew? After trying a few different approaches, I now brew mine in the fridge for convenience, letting it steep for about a week to make a nice dark roast concentrate with Bizzy Organic Dark & Bold grounds. The result is stellar, easily better than any coffee place cold brew I've had in the past couple of years. Filled to the max line, a full pitcher lasts me about 2 weeks when I have about an inch of coffee per day. I've found cold brew concentrate to be an extremely economical way to stretch costly grinds while creating the richest flavor and this pitcher is a key part of that. With this approach, I'm a happy customer. One thing I like to do while brewing a new batch of coffee is pouring about 1/3 of the brewed coffee into a tall cup and finishing that while brewing. This method has worked perfectly for me, as I have a new pot of coffee by the time I'm done with the old one. One thing to point out is that the pitcher is fairly big and the glass is relatively thin. And so I have always hand washed all parts of this pitcher, which has proven straightforward enough. While borasilicate and stainless steel should be dishwasher safe, this has become too important a piece of equipment for me to start playing around with. So I'm not the person to say how well it holds up in a dishwasher. My outlook is to treat this pitcher with the care it deserves and to be rewarded with its offerings for as long as possible. Overall the pitcher is an all-star at making the coffee I enjoy, being so simple to use that it becomes easy to take for granted. It is almost a trouble-free piece of kitchen hardware and has already paid for itself through sheer convenience. The quality definitely feels top notch, although the thinness of the glass means it needs to be treated with the care and respect it deserves. I would feel very comfortable recommending this product to almost anyone serious about making a quality cold brew at home.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 29, 2020
L
Verified Purchase
Lance Seidman
West Palm Beach, US
★★★★★ 4
Better than expected (Updated)!
This is a simple and effective solution to making a good cold brew. Too bad the process takes forever (no fault to the product). BUT if you want a stronger taste, after using purified cold water (try to get beans wet), let it sit out for 12 hours or longer but then place in the fridge and you'll notice it darker and richer. It is impossible if you think some ground beans won't end up in your coffee, they will BUT when you pour, as long as you leave the metal ring in, a little bit of coffee (water) and the beans usually get stuck and don't come out. If you're really nuts about it, you can use a cheese cloth but a bit of grounds won't hurt you and not sure you'd really taste it as it's so fine, barely noticeable. Those who keep braking the glass? You must use cold water if you immediately start cleaning the pot. Do NOT run under hot water while the pot is cold, you or course will shatter the glass at some point. Update (07/29/2020) I am still using this product and no issues with it. But it does leave the coffee grounds smell to it no matter what beans I use, so wash with soap after every use. Be sure to know, water will evaporate and also get soaked up in the coffee beans, so adding a little more water above Max may be helpful. Also, pro tip, when you take out the insert with the beans, put it over the lid and tilt it and let it rest for 3 Mins so all the water from the beans pours out, do NOT force it with your fingers as you'll get more grounds and will have a harsh flavor.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2020
F
Verified Purchase
Faye-Lee Chang
Boise, US
★★★★★ 5
Great for iced tea and easy to use
Style: 51oz|Conical Styles
I use this for making iced tea and it works perfectly. You can use tea bags or loose-leaf tea, and both come out great. It’s easy to fill, strain, and clean, and I like that I can just keep it in the fridge and pour as I go. The airtight seal keeps everything fresh. Super convenient and a staple for my fridge now
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 3, 2025
E
Verified Purchase
Elise Kennedy
Birmingham, US
★★★★★ 5
Great for tea!
Style: 51oz|Straight Styles
Love this pitcher! Use it for my NORA pregnancy tea to steep overnight in the fridge.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2026

recommand products