SKU: 3597217334

Pig Intrinsic Factor Protein, His Tag

$123.75 $137.50
Save 10%
No.2 Bestseller on sm10m.ch >

Pay in installments of $34.38 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 3 - Sep 8

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Pig Intrinsic Factor Protein, His TagProduct Specification Synonyms Cobalamin binding intrinsic factor, CBLIF Accession A0A8D1ENZ1 Amino Acid Sequence Protein sequence (A0A8D1ENZ1, Ser27 Try425(S90T, R247Q), with C His Tag)

Product Specification


Synonyms Cobalamin binding intrinsic factor, CBLIF
Accession A0A8D1ENZ1
Amino Acid Sequence

Protein sequence (A0A8D1ENZ1, Ser27-Try425(S90T, R247Q), with C-His Tag) STQTRSSCSVPSAEQPLVNGIQVLMEQSVTSSAFPNPSILIAMNLAGAYNTEAQELLTYKLMATNTSDLTTGQLALTIMALTSSCRDPGNRIAILQGQMENWAPPSLDTHASTFYEPSLGILTLCQNNPEKTLPLAARFAKTLLANSSPFNMDTGAMATLALTCMYNKIPVGSEEGYRALFSQVLRNTVENISMRIQDNGIIGNIYSTGLAMQALSVTPEQPNKEWDCQKTMDTVLTEIKEGKFHNPMAIAQILPSLKGKTYLDVPHVSCSPGHEVPPTLPNHPSPVPTPAPNITVIYTINNQLRGVELLFNETISVSVKRGSVLLIVLEEAQRKNPKFKFETTMTSWGPVVSSINNIAENVNHRTYWQFLSGQTPLNEGVADYIPFNHEHITANFTQY
Expression System HEK293
Molecular Weight Predicted MW: 45.4 kDa Observed MW: 50-55 kDa
Purity ＞95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Cobalamin-binding intrinsic factor (CBLIF) is a glycoprotein primarily secreted by gastric parietal cells in pigs, which plays a vital role in cobalamin (vitamin B12) absorption. It binds to dietary cobalamin with high specificity in the stomach, forming a stable complex. This CBLIF-cobalamin complex is resistant to intestinal degradation and is specifically recognized by cubilin receptors on the mucosal surface of the distal ileum, facilitating its active transport into enterocytes. Therefore, CBLIF is essential for the efficient uptake and systemic delivery of vitamin B12, a critical cofactor for DNA synthesis and red blood cell formation.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 3597217334

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
KIMBERLY
Charlottesville, US
★★★★★ 5
Spicy racks
Item Package Quantity: 2, Item Package Quantity: 2
I bought these as I needed to organize my spice cabinet. I was using a lazy Suzanne and the spices kept falling off them. These fit perfectly in the cabinet,I attached them using the command Velcro stickers that come off easy. I am in an apartment. They are strong enough to allow the shelves to slide out.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2026
A
Verified Purchase
Amazon Customer
Chelsea, US
★★★★★ 5
Great product
Item Package Quantity: 2
Fit perfectly in my cabinet and gives me the room and accessibility I was looking for. Being 5'4 and needing a step stool to reach my spices above the microwave was pretty annoying. They are solid, quality racks. Very easy to assemble and adheres well to the cabinet.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026
S
Sorilea
West Palm Beach, US
★★★★★ 4
Great Quality, but Check Cabinet Height Carefully
Item Package Quantity: 2
I am so, so sad these iSpecle Pull Out Spice Racks did not fit in my kitchen cabinets. I thought I had checked, but the most my cabinets can take with the nonadjustable shelves is 9", and these are a little over 9.5" tall at the metal rack side. They may not fit where I intended to use them, but they appear to be good quality and really help with organization. They look nice and slide in and out well, so I fully intend to find another way to use them. Maybe under the bathroom sink where smaller items also like to cluster.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
S
Verified Purchase
sue d
Carnegie, US
★★★★★ 5
How easy they are. And space saving
Item Package Quantity: 2
These are great. Made such a difference in my cupboards. Would rate as a 10
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
J
Julie B
Omaha, US
★★★★★ 5
Finally solved my spice cabinet chaos
Item Package Quantity: 2
I didn’t realize how much time I was wasting digging through my spice cabinet until I installed these. My spices used to be stacked behind one another, which meant every time I needed a specific seasoning, I had to move half the cabinet around just to find it. These racks completely solved that problem. What immediately appealed to me was the no-drill installation. I rent my home, so I’m always hesitant to make permanent changes to cabinets. The peel-and-stick setup was surprisingly easy, and I had both racks installed in just a few minutes. Once attached, they felt much more secure than I expected. I was initially skeptical about adhesive mounting, but they’ve stayed firmly in place. The pull-out design is where these really shine. Instead of reaching into a dark cabinet and searching through rows of jars, I can simply slide the rack out and instantly see everything. It’s one of those organizational upgrades that makes everyday cooking noticeably easier. I also appreciate the adjustable height feature. My spice collection includes a mix of different bottle sizes, and I was able to configure the racks to accommodate both smaller and larger containers without any issues. The flexibility makes them much more useful than fixed-size organizers. Another thing I noticed is how much cabinet space they helped free up. By using vertical space more efficiently, my cabinet feels less cluttered and much more organized. I can now find exactly what I need without knocking over other jars or creating a mess. The overall construction feels sturdy, and the sliding action remains smooth even when the racks are fully loaded. This is one of those products that seems basic but ends up making a bigger difference than expected. If your spice cabinet is crowded, disorganized, or constantly frustrating to use, these racks are an easy solution. They’ve made cooking more convenient, improved organization, and helped maximize storage space. For me, that’s an easy five-star product.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026

recommand products

Exposure Lights Revo Dynamo Front Hub/Light Set 100mm QR 32 Hole Rim Brake Black
72.99
【新品】MIXED:06 / Trinity Note 発売日:2014-08-17
11.00
SRAM Red eTap AXS Right/Rear Shifter Lever 12 Speed
140.00
【新品】叛逆のファンタスマゴリア / IOSYS 発売日：2014-05-11
11.00
Feedback Sports Pedal Wrench Combo
26.00