SKU: 35152705855

Human Geminin , His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 16 - Sep 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Geminin , His tagProduct Specification Species Human Synonyms GMNN Accession O75496 Amino Acid Sequence Protein sequence(O75496, Leu110 Ile209, with C 10*His) MLYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCIGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Theoretical: 13. 1kDa Actual: 19kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer Lyophilized

Product Specification


Species Human
Synonyms GMNN
Accession O75496
Amino Acid Sequence

Protein sequence(O75496, Leu110-Ile209, with C-10*His)
MLYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCIGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Theoretical:13.1kDa Actual:19kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Geminin is a nuclear protein present in most eukaryotes and highly conserved across species, numerous functions have been elucidated for geminin including roles in metazoan cell cycle, cellular proliferation, cell lineage commitment, and neural differentiation. One example of its function is the inhibition of Cdt1. Geminin has been found to be overexpressed in several malignancies and cancer cell lines, while there is data demonstrating that geminin acts as a tumor suppressor by safeguarding genome stability.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 35152705855

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
Y
Verified Purchase
YouNeedMorePeople
West Palm Beach, US
★★★★★ 3
Too compromised for the price
HDR: Windows 10/11 report 1015nits peak brightness which is its real peak luminance. Quantum HDR2000 is a fabricated specification unique to Samsung. In real content (games/movies) it is no where near capable of 2000nits and instead barely produces over 800nits peak brightness for 10% highlight. The 2000nit figure comes from best case scenario - 10% test slide used by calibrators and reviewers to measure luminance. The monitor detects such a scenario and temporarily boosts brightness so that they can publish impressive brightness figures. Yes this is essentially cheating and Samsung has been called out recently for the same "trick" on their TV's. Samsung could have opted to have the monitors HDR performance certified by VESA but chose not to in favor of their own marketing favorable terminology. In reality the monitor is some where between VESA DisplayHDR600 and DisplayHDR1000 due to a combination of Samsung severely limiting brightness for the sake of preventing blooming alongside possibly preventing the backlight from being overdriven to manage thermals. Scanlines: The monitor displays horizontal scanlines at its maximum 4K 240hz refresh rate. This is a limitation of the display driver or scaler and has been present on all 1440p+ 240hz Samsung monitors dating back to the original G7. This is not a software/firmware issue as the original G7 and Neo G9 still suffer from it to this day after over a dozen firmware updates between the two. Dropping down to 120hz rids you of scanlines but then you have to ask, why did I buy a 240hz display? A compromise is using a custom resolution/refresh rate of 165hz but then you have to ask yourself, why didn't I save $200 and purchase the Neo G7 instead? Anything above 165hz and the scanlines get very noticeable. Anti Reflective Coating: The Neo G8 uses a completely different AR coating compared to the Neo G7. Its extremely thick/hazy and has a sparkly sheen to it and as a result is a huge detriment to clarity. HDMI 2.1: As of right now the monitors HDMI 2.1 ports are either broken due to a firmware mishap or not full bandwidth HDMI 2.1 ports. 4K 120hz is the max possible refresh rate using an HDMI 2.1 capable GPU and even that can be finicky at times. DSC should make 4K 240hz possible just like the Displayport 1.4 port but its just not working correctly at the moment. Curve: The curve is non uniform and extremely aggressive at the center while flattening at the sides. It results in a very odd almost crease like presentation dead center and takes quite a bit of adjustment. I understand the 1000R curve is done to compensate for the VA panels poor viewing angles but its just too much for desktop/productivity and warps everything you're looking at. 1800R or 1500R max would be ideal although I wish Samsung would ditch this obsession with curves and just give us flat panels. Neo G7 vs Neo G8: So why buy the Neo G8? Well there really is no reason unless you enjoy horizontal scanlines at 240hz. The Neo G7 has the same HDR brightness (1015nits reported to Windows), gets you 165hz scanline free without having to fiddle with custom resolutions, uses a more traditional matte anti glare coating and as of writing this review appears to have the same HDMI 2.1 limitation.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 30, 2022
S
Verified Purchase
Steve B.
Carnegie, US
★★★★★ 5
WHAT YOU NEED TO KNOW! And why people have issues with this Monitor, It's their fault.
Got mine today! Great packaging, no dead pixels! LOOKS AWESOME! This is what you need to know before buying this Monitor! Please read SO YOU KNOW! It will also help you with any other monitor, video card, or cables. This is a 4K 240Hz Monitor! There are 3 different versions of this Monitor in the user manual, and Samsung has never been great on literature to know what you need to push this monitor to its full potential. I read the 4-star reviews for this Monitor first. In there, I read about a guy who was getting tearing and replaced the DP (Display Port) cable to a 16K cable. I want to explain this to educate people and help. The base refresh rate for any resolution is 60Hz, so let's do the math backwards to fully understand. 16K at 60Hz = 8K at 120Hz = 4K at 240Hz = 2K at 480Hz Since not only Samsung, but every corporation tries to save money, the other 2 monitors in the user's guide doesn't require a 16K cable. Since I'm sure they all have the same packaging, there's no reason to believe the supplied DP (Display Port) cable is 16K. In Fact, I can see nothing on the cable that says so. However, I spent $6 for a 10' 16k cable delivered with the Monitor. This is the most important thing to know once you have your 16K DP (Display Port) cable. To push 16K your device (Video Card) has to have DP (Display Port) 2.1 AMD was on top of the ball on this and uses DP (Display Port) 2.1 for its RX 7000 series and up. I use a RX 7900XTX, so I'm covered. Nvidia used DP (Display Port) 1.4 on their RTX 4000 series cards to save money and charge you way too much! Nvidia implemented DP 2.1 on their RTX 5000 series cards. I don't know for INTEL cards; I would search the specs. I've read reviews from RTX 4000 people, and I can only assume that they don't understand that Nvidia DLSS has to be a factor, they aren't aware that their video cards can't push a true 4K at 240Hz. The last thing to add is the Dimensions that Samsung Provides! Yes, its 27" tall! But it's a telescopic stand, I only have 20.5" clearance, and it fits nice. I think it could go down to 19". Power Color Hellhound RX 7900 XTX AMD 9950 X3D Asus Rog Strix X870E-E Gaming Wi-Fi 32GB G.Skill Royal Neo at 8000Mhz Nothing else is important for this post
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 15, 2025
A
Verified Purchase
Amazon Customer
Lake Worth, US
★★★★★ 5
Music and video editing. This thing works.
Size: 49-1, Size: 49-1
49" curved. It's a good monitor. Confirmed resolution is 5K. I had never heard of ZZA before but the reviews were good and the price was decent. Honestly, I did not expect too much. Well, this monitor is well packaged, easy to handle and use, built nicely. The screen has a matte low-reflection surface and looks smooth. Tested with Ableton, DaVinci, WOW, Zoom, and a few others. Instantly improved my workflow by displaying longer timelines in music and video. Games like WOW are very immersive, but it takes a few hours to get used to. Once you get into it, it might be had to go back to a normal flatscreen. Overall, it's worth the money. ZZA is evidently taking this very seriously with a decent design and a solid feel. Would recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 2, 2026
T
Verified Purchase
Trisha Hagensick
Houston, US
★★★★★ 5
Great monitor
Was looking for an extra monitor to use for when working from home. The picture quality is perfect for just normal work use. The ports are easy to access for plugging in cords. Was easy to set up with the docking station as well. Worth the money.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026
H
Verified Purchase
Hudson Rechsteiner
Pawtucket, US
★★★★★ 5
Great Screen
Size: 27
For the price, you can not beat the picture quality. It is great for me and is a perfect size for warzone.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026

recommand products