SKU: 2910228855

LCOR His Tag Protein, Human

Sale price$271.80 Regular price$302.00
Save 10%

Pay in installments of $75.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LCOR His Tag Protein, HumanProduct Specification Species Human Antigen LCOR Synonyms mblk1 related protein 2 Accession Q96JN0 Amino Acid Sequence Met1 Glu433, with N terminal 8*His

Product Specification


Species Human
Antigen LCOR
Synonyms mblk1-related protein 2
Accession Q96JN0
Amino Acid Sequence

Met1-Glu433, with N-terminal 8*His HHHHHHHHGGGSMQRMIQQFAAEYTSKNSSTQDPSQPNSTKNQSLPKASPVTTSPTAATTQNPVLSKLLMADQDSPLDLTVRKSQSEPSEQDGVLDLSTKKSPCAGSTSLSHSPGCSSTQGNGRPGRPSQYRPDGLRSGDGVPPRSLQDGTREGFGHSTSLKVPLARSLQISEELLSRNQLSTAASLGPSGLQNHGQHLILSREASWAKPHYEFNLSRMKFRGNGALSNISDLPFLAENSAFPKMALQAKQDGKKDVSHSSPVDLKIPQVRGMDLSWESRTGDQYSYSSLVMGSQTESALSKKLRAILPKQSRKSMLDAGPDSWGSDAEQSTSGQPYPTSDQEGDPGSKQPRKKRGRYRQYNSEILEEAISVVMSGKMSVSKAQSIYGIPHSTLEYKVKERLGTLKNPPKKKMKLMRSEGPDVSVKIELDPQGEAAQSANESKNE

Expression System HEK293
Molecular Weight 75-80kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.J Biol Chem. 2017 Nov 17; 292(46): 18973–18987. Published online 2017 Sep 26.

Background

LCoR (ligand-dependent corepressor), also known as MLR2 (Mblk1-related protein 2), is a 47-50 kDa nuclear phosphoprotein that is a corepressor of ligand-dependent transcriptional activation by nuclear receptors such as estrogen and progesterone receptors. The 433 amino acid LCoR contains two N-terminal PxDLS nuclear receptor interaction motifs, a central HDAC interaction motif, a nuclear localization signal, and a C-terminal Helix-Turn-Helix motif. Nuclear receptors (NRs) regulate gene transcription by recruiting coregulators, involved in chromatin remodeling and assembly of the basal transcription machinery. The NR-associated protein ligand-dependent corepressor (LCoR) has previously been shown to suppress hepatic lipogenesis by decreasing the binding of steroid receptor coactivators to thyroid hormone receptor.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 2910228855

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Shannon 71
San Leandro, US
★★★★★ 5
Cheap comfy quick delivery
Color: Black, Size: Queen (Pack of 2)
I bought these for my daughter and her dude, they love them! They aren't expensive very comfortable came to life quickly. If your looking for a quick delivery inexpensive and comfy this is your pillow. From what I've seen of them fluffy but not too fluffy 😉
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 7, 2026
T
Verified Purchase
The Fingernail Reviewer
Fort Morgan, US
★★★★★ 4
Pillowriffic
Color: White, Size: Queen (Pack of 2), Color: White, Size: Queen (Pack of 2)
These pillows are exactly as described, I would say they are softer than I expected but still very good. They come compressed so it will take an hour or so for them to fill up so you will want to open these before bedtime. All in All if you are looking for a reasonably priced pillow that will last a couple of months I would recommend these.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 7, 2026
N
Verified Purchase
NF-Calif
Alexandria, US
★★★★★ 5
Great buy
Color: White, Size: Queen (Pack of 2)
I was very skeptical about buying pillows online. I am pleasantly thrilled with these pillows. They are great quality. They maintain their shape by simply shaking occasionally if needed. The fabric is really soft to the touch. They don't go flat after a few uses. I've had them for almost 6 months. I waited to review to make sure they didn't disappoint.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 6, 2026
P
Verified Purchase
Philly Gurl
New York, US
★★★★★ 5
LOVE THEM!!! SAVED MY NECK!!!
Color: White, Size: Queen (Pack of 2)
Hallelujah!!! After spending so much money on pillows that didn't work for my aching neck and shoulders, I finally found pillows that works for me and I am SOOOOOO excited. I had my 1st night of comfortable sleeping after years of restless, painful nights. These pillows are the BOMB! I kid you not. I have spent hundreds of dollars on pillow to no avail. I mean, the expensive hotel pillows that were suppose to make you feel as if you're sleeping on clouds made my neck stiff and painful. Let's not talk about that "infamous pillow: advertised on the infomercial that was suppose to be the #1 pillow to fight against neck and back pain. Shhhh, we won't say the name but uh....TRASH. Ok, I'm back. Lost it there for a moment thinking of all the money I wasted on all those pillows that claimed to be "THE PILLOW." LOL..what a joke. So, anyway back to what I was saying about this pillow beauty. The very 1st night I slept on it, I'll admit I was skeptical when I laid down. Scared I was going to wake up with a sore neck and headache to go along with it. I tore the package open, let the pillow inflate, fluffed them with my hands and allowed them to sit for a few hours. I didn't wait the allotted time suggested because I was too anxious to try them and it was almost my bed time. So, excitedly I jumped in bed, laid my head down on the pillow and immediately thought, "oh no, these are too soft. This will not work." I just knew I would wake up to a sore neck. Cautiously, I laid down and waited to drift off, dreading waking up the next morning with a stiffer. (LOL) To my surprise I actually slept all night too. I usually would wake up like a thousand times fighting with repositioning the pillow to find my comfort zone. WOW, not that night. I slept like a baby and wait for it.....I woke up the next morning with NO PAIN! Hallelujah! I couldn't believe it. I was literally pain free in my neck and did not have a headache from the strain on my neck, shoulders and back. Man, is this really happening, I asked myself. This just can't be real. Wake, wake girl. You are dreaming. But nope. I was fully awake and with a pain free neck and shoulders. I jumped up and started getting ready for my day. I finally found the pillow that I wish I had found years ago. Could have saved so much $ from going down the drain. I am SO thankful to all the reviews that I read that shared their positive experience and encouraged me to purchase for myself. I am SOOOO GLAD I took a chance and brought these little beauties. They saved my neck and my sanity. Thank you EIUE Hotel Collection for inventing the pillow that is reasonably priced and that does the job it's intended to do. Allow people to have a good nights rest WITHOUT neck, shoulder and back pain. Your Rock! This is a real review and I am a real person.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 15, 2025
A
Verified Purchase
Amazon Customer
Houston, US
★★★★★ 3
Flat
Color: White, Size: Queen (Pack of 2)
They are long pillows but definitely flat, I tried and tried to fluff them up and they are about like the $3 Walmart pillows. I will be returning these
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026

recommand products