SKU: 24734907685

Human IL-12A, His tag

Sale price$166.50 Regular price$185.00
Save 10%

Pay in installments of $46.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 22 - Aug 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-12A, His tagProduct Specification Species Human Synonyms Cytotoxic lymphocyte maturation factor 35 kDa subunit (CLMF p35), IL 12 subunit p35, NK cell stimulatory factor chain 1 (NKSF1), NKSF1 Accession P29459 Amino Acid Sequence Protein sequence (P29459, Arg23 Ser219, with C 10*His)

Product Specification


Species Human
Synonyms Cytotoxic lymphocyte maturation factor 35 kDa subunit (CLMF p35), IL-12 subunit p35, NK cell stimulatory factor chain 1 (NKSF1), NKSF1
Accession P29459
Amino Acid Sequence

Protein sequence (P29459, Arg23-Ser219, with C-10*His) RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 24.2 kDa Observed MW: 35-45 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Interleukin-12 subunit alpha (IL-12 p35) is a protein that in humans is encoded by the IL12A gene. This gene encodes a subunit of the cytokine Interleukin 12 (IL-12) that acts on T and natural killer cells, and has a broad array of biological activities. The cytokine is a disulfide-linked heterodimer composed of the 35-kD subunit encoded by this gene, and a 40-kD subunit that is a member of the cytokine receptor family. This cytokine is required for the T-cell-dependent induction of interferon gamma (IFN-γ), and is important for the differentiation of both Th1 and Th2 cells. The responses of lymphocytes to this cytokine are mediated by the activator of transcription protein STAT4. Nitric oxide synthase 2A (NOS2A/NOS2) is found to be required for the signaling process of this cytokine in innate immunity.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 24734907685

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
H
Verified Purchase
Hobbes0516
Carnegie, US
★★★★★ 5
Perfect spray sunscreen
Style: SPF 50, Size: 5 Fl Oz (Pack of 1)
Arrived quickly! Best spray on sunscreen I have used /effective!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 22, 2026
B
Verified Purchase
Beboncho
Louisville, US
★★★★★ 5
Great Smell and No Mess Sunscreen
Style: SPF 50, Size: 5 Fl Oz (Pack of 1)
Love the smell and it brings great memories. Anytime we go to the beach or pool, this is very easy to apply and no mess. I love this sunscreen and would recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 23, 2026
R
Verified Purchase
rick
Omaha, US
★★★★★ 5
No sun burn
Style: SPF 50, Size: 5 Fl Oz (Pack of 1)
Last and last
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 7, 2026
L
Verified Purchase
Lilly Y.
Houston, US
★★★★★ 4
good spray, but strong alcohol smell
Style: SPF 50, Size: 5 Fl Oz (Pack of 1)
I like Alba Botanica, but 3.5 starts since: - the spray goes way too fast (that can be true for all continuous sprays). I used it 4 - 5 times and it seems I have very little left. - lots of waste when spraying... probably is best to spray your palm and then massage it on your body - once it's sprayed it smells like alcohol, alot!!! Other brands I tried don't seem to smell so much of alcohol. - My kid developed strange rash once it was applied, not red dots, but white bumps all over the arms and legs, cannot say its from this spray, but I'm a bit suspicious. The good party it's it is not sticky or greasy. Smells good (after alcohol evaporates). I used it a couple of times, applied once only and stay several hours under the sun and I was fine, no sunburn.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 20, 2016
S
Verified Purchase
Sunni A.
Phoenix, US
★★★★★ 5
Love it!
Style: SPF 50, Size: 5 Fl Oz (Pack of 1)
Love this stuff and it's cruelty free!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 4, 2026

recommand products